Navigation Links
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

ProductsMouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Company Abnova Corporation
Item Mouse Anti-FES Polyclonal Antibody, Unconjugated
Price 
Description Mouse polyclonal antibody raised against a partial recombinant FES.
Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA
Accession: BC035357
Protein Accession Number: AAH35357
OMIM: 190030,
GeneID: 2242
Lot Number: MM950404136
MA Code: ABVAP62HR
Operation Date: 2006/12/22
Info Abnova CorporationAbnova Corporation
Abnova Corporation (HQ)
9th Fl., No. 108, Jhouzih St.
Neihu District, Taipei
114 Taiwan R.O.C.
Tel: +886-2-8751-1888
Fax: +886-2-8751-1166

Abnova GmbH
Boxbergring 107
69126 Heidelberg
Germany
Tel: +49 6221 3632226
Fax: +49 6221 825878

Customer Service: +886-2-8751-1888
Fax Number: +886-2-8751-1166
Web Site: http://www.abnova.com.tw
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Mouse Anti-Amodiaquine Monoclonal Antibody, Unconjugated, Clone 6D10 from AntibodyShop A/S
2. Mouse Anti-Protein S Monoclonal Antibody, Unconjugated, Clone HYB 232-02 from Abcam
3. Mouse Anti-Mouse Glutathione S-transferase M1 (GSTM1) Monoclonal Antibody, Unconjugated from Lifespan Biosciences
4. Mouse Anti-Human S-100 alpha/beta chain Monoclonal Antibody, Unconjugated, Clone 8B10 from Santa Cruz Biotechnology, Inc.
5. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies
6. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies
7. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies
8. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (19 - day) from OriGene Technologies
9. Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Thymus from OriGene Technologies
10. Mouse Anti-Human Complement factor B Monoclonal Antibody, Unconjugated, Clone 9B6 from AntibodyShop A/S
11. Mouse Anti-Human Choriongonadotropin (hCG) Monoclonal Antibody, Unconjugated, Clone 5F10 from AntibodyShop A/S
Evolutionarily conserved signaling intermediate in Toll pathway
Amino-acids and Derivatives Rabbit Anti-conjugated L-isoleucine Polyclonal Antibody
Phosphatidylinositol transfer protein beta isoform (PtdIns transfer protein beta) (PtdInsTP) (PI-TP-beta). [Source:Uniprot/SWISSPROT;Acc:P48739] Antigen: Recombinant Protein Epitope Signature Tag
Anti-MMP-25 (Membrane-type MMP-6, Mt6MMP), hinge region; rabbit host
Biology Products:
(Date:11/20/2008)...OD CITY, Calif., Nov. 19 DigitalPe...olutions, today announced DigitalPersona,Personal... individuals, family,members and business users. ...,protection suite to use biometrics, letting peopl...s -- including email, banking, shopping, and other...
(Date:11/20/2008)...euroscientists at Barrow Neurological Institute at...covered a direct link between eye motions and the ...ar-old debate. , Stephen Macknik, PhD, directo... Susana Martinez-Conde, PhD, director of the Labor...hD; and Jorge Otero-Millan; conducted a study base...
(Date:11/20/2008)...is release is available in German . , Hall...get a comprehensive overview of which alien specie...ences for the environment and society. More than 1... (Delivering Alien Invasive Species Inventory for ... more than 100 European scientists, funded by the ...
(Date:11/20/2008)...CAGO -- The body,s immune system hates strangers. ...annihilates it. , This is the problem when peopl...ansplantation. The islet cells from a donor pancre...ient -- often permitting independence from insulin... the new hard-working islets. , A person who has...
Breaking Biology News(10 mins):DigitalPersona Places Identity Protection at People's Fingertips 2DigitalPersona Places Identity Protection at People's Fingertips 311,000 alien species invade Europe 2New technique eliminates toxic drugs in islet transplant in diabetic mice 2Worlds First Cattle Vaccine to Reduce E coli O157 Threat Receives Full Licensing Approval in Canada 27738 1Worlds First Cattle Vaccine to Reduce E coli O157 Threat Receives Full Licensing Approval in Canada 27738 2Worlds First Cattle Vaccine to Reduce E coli O157 Threat Receives Full Licensing Approval in Canada 27738 3Worlds First Cattle Vaccine to Reduce E coli O157 Threat Receives Full Licensing Approval in Canada 27738 4Worlds First Cattle Vaccine to Reduce E coli O157 Threat Receives Full Licensing Approval in Canada 27738 5Worlds First Cattle Vaccine to Reduce E coli O157 Threat Receives Full Licensing Approval in Canada 27738 6GenVault to Present at the BIOCOM Investor Conference 8605 1Electrochromic Display Technology Announcement 8601 1Electrochromic Display Technology Announcement 8601 2Alzheimers Strikes Every 71 Seconds 21 Carefree Senior Living Press Releases New Book 3A What the Heck Do We Do Now 3F Families Facing Alzheimers 27732 1Alzheimers Strikes Every 71 Seconds 21 Carefree Senior Living Press Releases New Book 3A What the Heck Do We Do Now 3F Families Facing Alzheimers 27732 2
...t close-up look at a pro-inflammatory signaling mo...ests that researchers "should rethink what they ar...del, scientists say. , Reporting in the Oct. 1 iss...e University of Illinois at Urbana-Champaign unvei...eceptor-associated kinase-4 (IRAK-4). , They foun...
...he study of aging in the nematode model organism C...lex process, it is not yet clear whether genes inv...mammals. In a recent study, Dr. Hekimi and collea...ctivation of the gene mclk1, the murine ortholog o...cellular fitness and prolonged lifespan in mice. ...
...o the project website , The annual Educational ... this year been granted to the project ,Virtual mi...rmatics Research Group of the university. The awar...network technology to digitise, store, and view mi...specimens, incorporated into educational applicati...
...ns of babies born very prematurely do not develop ...ording to new research presented today at the annu...ington, D.C. , Dr. Sandra Witelson, a professor of...ichael G. DeGroote School of Medicine at McMaster ...iplinary project at Hamilton Health Sciences, said...
Other Biology News:Molecular research suggest shift needed in how some drugs are created 2Evolutionary conservation of a mechanism of longevity from worms to mammals 2Womb needed for proper brain development 2
(Date:11/21/2008)... 20 years of commercial life sciences sales experi...PRNewswire/ -- Cyntellect, a privately-held life s...cialization of live cell analysis and manipulation...dre Lubarsky as the Company,s Director of Sales - ...ales of Cyntellect,s cell purification and cell he...
(Date:11/21/2008)... LCA-Vision Inc. (Nasdaq:...rection services under the,LasikPlus(R) brand, to...ezze,to the position of Chief Financial Officer o... Mr. Celebrezze, who has served as interim CFO sin...cutive Management team as Senior Vice,President o...
(Date:11/21/2008)...PRNewswire-FirstCall/ -- Gen-Probe,s (Nasdaq: GP...rtant new molecular tool to more,accurately detec...that are,associated with cervical cancer or preca...ions and two scientific posters presented last wee... international conference of the,European Researc...
(Date:11/20/2008)... 20 BioSpecifics,Techno...maceutical company,developing first in class coll...pecifics, President, Thomas Wegman, will present a...are Conference on Tuesday, December 2, 2008, at,4... NY. , A live webcast of the presentation c...
Breaking Biology Technology:Cyntellect Appoints Former BD Biosciences Executive Andre Lubarsky as Director of Sales - North America 2LCA-Vision Names Michael J. Celebrezze CFO 2LCA-Vision Names Michael J. Celebrezze CFO 3LCA-Vision Names Michael J. Celebrezze CFO 4Promising Clinical Data on Gen-Probe's APTIMA(R) HPV Test Presented at Major European Medical Meeting 2Promising Clinical Data on Gen-Probe's APTIMA(R) HPV Test Presented at Major European Medical Meeting 3Promising Clinical Data on Gen-Probe's APTIMA(R) HPV Test Presented at Major European Medical Meeting 4Promising Clinical Data on Gen-Probe's APTIMA(R) HPV Test Presented at Major European Medical Meeting 5
...- Its not news that Wisconsin trails national aver... and whys of it are broken down and detailed in a ... Capital published by NorthStar Economics, Inc. T... venture capital for Wisconsin companies. , ,The W...py of the 60-page report, a primer for Wisconsin c...
...oined Green Bays Nsight Telservices (www.nsighttel...perations after an action-packed stint as Chief Te...ld. Hansen oversees Northeast Telephone, Nsight Lo...nd heads up the company,s Digital Subscriber Line ...deployment. , , WTN: How did your dot-com experie...
...e difficult challenges in business is turning arou...er water and the company is forced into bankruptcy...really are is sometimes difficult or impossible fo...ully. They grasp at straws hoping somehow a miracl...standing proposal, and things will be back on trac...
...h Performance ,Todays business conditions provide.... While the battles for talent might appear to ha...ms who move beyond battlefield tactics to long-ter...comes from making a clear choice in your overall t...ent management practice to that choice, even when ...
Other Biology Technology:Growing Venture Capital in Wisconsin 2Growing Venture Capital in Wisconsin 3Interview: WTN Gets Real with Appletons Brad Hansen - Dot-Com Experience helps Executive to Spot Trends 2Interview: WTN Gets Real with Appletons Brad Hansen - Dot-Com Experience helps Executive to Spot Trends 3Turning Around a Sick Company 2Talent Constellations or Talent Communities Choosing the Right Talent 2Talent Constellations or Talent Communities Choosing the Right Talent 3