Tag: "according" at biology news

Student science contest participation influences study, career choices, alumni say

... career paths for a large majority of contestants, according to a survey released today to mark National Biotechnology Week in Canada. Almost three-quarters (74%) of 350 past contestants said the Aventis Biotech Challenge (ABC) helped them plan their studies or find vocations in fields such as biotechnology, ...

Houston minority graduation rises in sciences, engineering as result of UH-led alliance

...y, engineering and mathematics (STEM) disciplines, according to independent external evaluators of the National Science Foundation (NSF) program. Preparing students for entry into graduate programs, an important goal of H-LSAMP is to increase the number of doctoral graduates and professors of Hispanic, Af...

Circulation of 'disaster myths' in Haiti could hinder appropriate disposal of bodies

...owing the floods in Haiti, and need to be checked, according to a public health researcher who has studied the potential risks at length. Although most of the media coverage of the disaster has been responsible and accurate, there have been some reports which wrongly state that dead bodies can cause epidemics....

New study shows hope for treating inhalant abuse

... percent of inhalant users are 12 to 25 year olds, according to the 2002 National Survey on Drug Use and Health performed by the U.S. Substance Abuse & Mental Health Services Administration. Stephen Dewey and Jonathan Brodie, a psychiatrist at the New York University School of Medicine, have collaborated...

Cigarette smoke causes breaks in DNA and defects to a cell's chromosomes, Pitt study finds

... information being passed to a newly divided cell, according to University of Pittsburgh researchers. Their findings, to be reported Tuesday, Oct. 5 at the 35th Annual Meeting of the Environmental Mutagen Society, are the first to show that cigarette smoke causes chromosome instability. The meeting, "Genes, M...

Molecular motor implicated in tissue remodeling

...r that extracts its fuel from the road it runs on, according to researchers at Washington University School of Medicine in St. Louis. Their discovery appears in the Oct. 1 issue of Science. The enzyme, MMP-1, is a member of a group of enzymes that breaks down collagen, a fibrous substance that constitutes the ...

Cancer vaccine based on pathogenic listeria bacteria shows promise targeting metastases

...programs are focused on two novel cancer antigens, according to a recent company press release. Cerus is collaborating with Johns Hopkins University to develop a listeria-based vaccine targeting pancreatic and ovarian cancers that express the Mesothelin antigen, and has partnered with MedImmune, Inc., to devel...

Study: Emission of smog ingredients from trees is increasing rapidly

...s may have inadvertently worsened ozone pollution, according to a study led by Princeton University scientists. The study examined a class of chemicals that are emitted as unburned fuel from automobile tailpipes and as vapors from industrial chemicals, but also come naturally from tree leaves. These chemicals,...

Far more men than women favor routine paternity testing at birth

...vor routine paternity testing when a baby is born, according to a recent University of Washington survey, but the surprise to researchers is that the percentage of men favoring such testing wasn't higher. "The amazing thing is that the guys are always split 50-50. Age and income groups don't seem to matter," ...

UCSF scientist Joe Derisi named MaCarthur Fellow

...ected through a rigorous and confidential process, according to the Foundation. No one can apply for the awards, and no interviews are conducted. "I have not before experienced anything coming close to the degree of transformation that Joe has brought about in our community," says Peter Walter, PhD, chai...

USAID, Conservation International & Starbucks launch Conservation Coffee Alliance in Central America

...animal diversity, and are under increasing threats according to CI. CI works directly with farmers to promote environmentally responsible growing practices such as water and soil conservation, crop diversification, and chemical fertilizer and pesticide reduction that help protect the surrounding forest, stream...

Hidden diversity: DNA 'barcoding' reveals a common butterfly is actually 10 different species

...ctually comprised of at least 10 separate species, according to researchers from the University of Pennsylvania. Astraptes fulgerator, a medium-large skipper butterfly, is a routine visitor to urban gardens and tropical rainforests. While the "species" has been known to science since 1775, only now has exami...

Wisconsin scientists develop quick botox test

...might inhibit the paralyzing effects of the toxin, according to Min Dong, a UW-Madison post-doctoral fellow and...rotection from botulinum poisoning. The new tests, according to Chapman, can be conducted with ordinary lab equipment. It works by introducing into cells biolum...

Knock knock knocking on rhythm's neural doors

...o different streams of 'e's are utterly different, according to a study done by a University of Southern California neural specialist and colleagues. The insight may lead to, among other things, better movement control by humanoid robots, but also new ways of movement rehabilitation. And perhaps it even offers...

Spun from bone

...d amino acids. People concentrated on this region, according to Shaw, because it has several negatively charged groups that are generally thought to interact with the positively charged groups in hydroxyapatiteor HAP, the crystals that make up bone and enamel. A series of experiments confirmed that this region...

Master of antimalarial resistance

... on the exact role that pfcrt plays in resistance, according to Fidock and colleagues. When a human is infected with malaria, the parasite lodges itself inside the red blood cells of its new host, drawing on the cells' hemoglobin molecules for sustenance. As the parasite digests the hemoglobin inside a membran...

Anthrax enzyme images reveal secrets of antibiotic resistance, suggest new drug design

...ulosis, pneumonia and a variety of other diseases, according to Kerim Babaoglu, the paper's first author. "The pharmaceutical industry is reducing its investment in developing new antibiotics," Babaoglu said. "So it's important that academic institutions fill in the research gap to ensure we will have effectiv...

Wolverine takes a road trip

...oss a variety of agencies and private land owners, according to Inman. Wolverines were nearly eliminated from the continental U.S. by around 1920, though some recolonization has taken place in recent decades. However, little is known about these rare carnivores, and previous proposals to list them as a feder...

Certain genes boost fish oils' protection against breast cancer

...etic makeup of study participants and grouped them according to which polymorphisms they had. They found that postmenopausal women who had low-activity versions of genes associated with GSTs (known as GSTM1, GSTT1 and GSTP1) had a lower risk of breast cancer. Women with a combination of the lowest-activity for...

AIBS tapped to coordinate design of ecological observatories

...in the nation's ecosystems and their consequences, according to Bruce Hayden, professor at the University of Virginia and principal investigator for the project. At NEON facilities across the country, researchers from various disciplines will work together to improve scientific understanding of several "grand ...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement