Tag: "aerosol" at biology news

Chemical derived from vitamin-E shows early promise as cancer drug

... effective. VES was effective when administered by aerosol but was not effective when given orally, probably because it is broken down into an inactive chemical form by intestinal enzymes. Kline will continue analyzing alpha-TEA activity and cellular effects in mice. Meanwhile, the chemical is goin...

Story tips from the Department of Energy's Oak Ridge National Laboratory, September 2004

...oratory researcher Mengdawn Cheng, is a high-speed aerosol instrument that measures highly variable properties of airborne particles and immediately provides scientists data regarding the composition of the air particulates. The instrument provides more accurate and concise readings than conventional monitor...

UC Irvine scientists to develop vaccine to combat bioterrorism threat from deadly bacteria

...domallei , an organism that can be dispersed by an aerosol spray and used as an agent for biological terrorism. The research will be supported by a $5.8 million grant from the National Institute of Allergy and Infectious Diseases, part of the National Institutes of Health. B. pseudomallei , which is resist...

Jefferson Lab detector technology aids development of cystic fibrosis therapy

...this problem by delivering gene therapy through an aerosol that patients can inhale. In a previous study, he found that dripping a solution containing a functioning copy of the cystic fibrosis gene (CFTR) into the noses of mice without the gene could successfully deliver it into the lungs. Successful ...

Protein vaccine fully protects mice from lethal aerosol challenge with ricin toxin

...ical threat agent, which fully protected mice from aerosol challenge with lethal doses of the toxin. The stud...-198 protected 10 out of 10 mice from a whole-body aerosol challenge with lethal doses of ricin. The survival rate was the same with or without the adjuvant. ...

DFG presents the 2004 MAK and BAT value lists

...nce in the workplace atmosphere as a gas, steam or aerosol that according to current knowledge does not impair the health of employees exposed during eight-hour working days over the long term. Furthermore, the working substances are classified according to their carcinogenic, germ cell mutagenic, reproducti...

Climate change Qs & As

... what aerosols do to the climate. The best current aerosol models give a cooling force, which is larger than we can explain. This must be balanced by other effects that are not properly accounted for in climate models. But eventually, warming caused by greenhouse gases will overwhelm any aerosol-related cool...

ESA consults European science community on candidate Earth Explorer missions

... provide additional information on distribution of aerosol and cloud optical properties, and a broadband radiometer will measure radiances. SPECTRA Surface Processes and Ecosystem Changes Through Response Analysis - to describe, understand and model the role of terrestrial vegetation in the global carbon cy...

New proteomics core at OHSU will speed discovery process

...h of a human hair. The result is a fine, liquid aerosol that generates peptide ions, which are then analyzed to help scientists determine their composition. "You want to get the most out of the least amount of material. We need to use liquid chromatography to spread out the complex mixture of peptides,...

Device detects, traps and deactivates airborne viruses and bacteria

...oy bioagents such as the smallpox virus. "When the aerosol particles come into the device they are charged an...has a core group of six faculty who are mainstream aerosol researchers, and work on different aspects related to Aerosol Science and Engineering. This national...

VaxGen reports Phase I clinical trial results of anthrax vaccine candidate

... similar doses of rPA102 were protected against an aerosol challenge with anthrax spores." The Phase I study was funded by VaxGen's contract N01-AI-25494 with the National Institute of Allergy and Infectious Diseases (NIAID), a component of the National Institutes of Health (NIH). VaxGen plans to launch two...

Astonishing discovery over the Amazonian rain forest

...t it didn't form products that could contribute to aerosol particle formation. Intensive measurements over th.... This represents between 5 and 25% of the organic aerosol formed by atmospheric photochemistry from biogenic precursors. This discovery is a breakthrough beca...

Symposium examines the growing influence of aerosols on climate

...wn clouds, new aircraft technologies for capturing aerosol particles, global climate impacts and the effects of black carbon on regional climate change....

Dirty air from Asia can push U.S. air pollution to unhealthy levels

... you'd wonder what was going on. It's a noticeable aerosol loading," he said. He noted that particulates of 2.5 microns or smaller can begin having health effects at concentrations of 40 micrograms per cubic meter. Since roughly half the particulates arriving from Asia were that small, that would mean citie...

UT Southwestern researchers receive $15.1 million in federal grants to study biothreats

...es can travel several miles and remain potent. The aerosol cloud would be colorless, odorless and invisible, and people indoors would receive the same amount of exposure as those outdoors. Inhalation anthrax is the most deadly of the three types. Initial symptoms resemble a common cold. In most cases, these ...

Envisat observes resurgent ozone hole

...g chlorofluorocarbons (CFCs) - in the past used in aerosol cans and refrigerators. But the bad news is that this year's ozone hole looks much more like the 2000 than the 2002 version. The latest ozone measurements acquired yesterday by the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) in...

DFG presents the new MAK and BAT Value List 2003

...king substance in workplace air as a gas, steam or aerosol that according to current knowledge does not impai...strict application are possible. Furthermore, the aerosol section was revised by adapting it to the current terminology in this field. Based on epidemiologica...

U.S. Army awards veterinary college researcher $1 million grant to develop vaccine

...World Health Organization Committee estimated that aerosol dispersal of 50 kilograms of virulent F. tularensis over a city of 5 million people would result in 250,000 inhabitants becoming seriously infected, including 19,000 deaths. One aspect of F. tularensis that makes it dangerous is its ability to resist...

Passing its global sight test leaves MERIS ready for work

...e also recorded, including surface pressure, local aerosol properties and how light scatters in the air. Raw MERIS results represent light recorded shining through the top of the atmosphere, but typically what is being sought after is located down at the base of the atmosphere. Indeed the signal received by...

The area where carcinogens settle may be a key factor in developing lung cancer

...ps of the local deposition patterns. In the model, aerosol particles were randomly selected at the inlet cross section with a random-number generator, in accordance with the assumed inlet air velocity profile. The inlet number and velocity distributions of particles followed parabolic distributions. Velocity...

1 2 3 4

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills