Tag: "binds" at biology news

Marijuana use could cause tubal pregnancies

...archers studied CB1, a "cannabinoid" receptor that binds the main active chemical for marijuana, delta-9-tetrahydrocannabinol (THC). In pregnant mice that lacked the gene for the receptor, or in which the receptor was blocked, the embryo failed to go through the oviduct the tube leading from the ovar...

Researchers ID chlorophyll-regulating gene

... The researchers targeted the PIF1 gene because it binds to phytochrome, a protein that is triggered by light and that controls a plant's growth and development. The researchers disabled the PIF1 gene in the species Arabidopsis thaliana, a mustard plant, and compared the mutant seedlings with a control gro...

Anthrax enzyme images reveal secrets of antibiotic resistance, suggest new drug design

...de findings give important clues to how the enzyme binds to DHPP and pABA. They also provide a blueprint of... Jude team also made a new drug-like molecule that binds to a part of the enzyme that is not likely to mutate and make the bacteria resistant to antibiotic m...

'Smart antibiotics' may result from UCLA research

... functions to diversify the part of the virus that binds to the bacterial cell. That cassette allows the phage to rapidly evolve new variants that can recognize bacteria that may have become resistant to the previous phage," Miller said. The microbiologists initially discovered the mechanism in a bact...

Scientists find nanowires capable of detecting individual viruses

...receptors used to snag them and because each virus binds to its receptor for a characteristic length of time before dislodging -- leaving only a minuscule risk of a false positive reading. "The fact that a nanowire array can detect a single virus means that this technology is the ultimate in sensitivity," ...

Scientists discover potential new way to control drug-resistant bacteria

...es of genes that change the part of the virus that binds to the bacterial cell. These genes allow the phage to rapidly evolve new variants that can recognize and attack bacteria that may have become resistant to the previous phage. "Phage therapy has been practiced for nearly a hundred years in parts of...

Protein is key to fatal disorder and normal cell function

...athy (mad cow disease). A protein on HIV's surface binds with GalCer and may be important in the transmission of the disease. The beta amyloid and prionic proteins also enter cells by binding to GalCer....

First glimpse of DNA binding to viral enzyme

...rt Einstein College of Medicine, to show where DNA binds on the adenovirus protease. "Synchrotron footprinting is a technique recently developed at Einstein that allows structural information on the contacting surfaces of biological molecules to be precisely mapped. These contact points are regions pro...

A probable cause for high blood pressure identified - shows links with diabetes

...l Academy of Sciences identified the molecule that binds to a receptor (a molecule on the cell surface that...rchers found that imidazole-4-acetic acid-ribotide binds to imidazol(in)e receptors which are widespread throughout the brain, and are abundant in the brains...

Images of 'tail' of protein needed for cell multiplication suggest anticancer drug targets

...author of the paper. "Although most of the E2 that binds with E1 and NEDD8 looks like any other E2, its tai...makes this enzyme unique." The tail of the E2 that binds to NEDD8 and the way the tail holds E2 onto E1 give this workshop a different shape than the ones in...

White House to honor UNC School of Medicine scientist for 'early career' achievement

...hromatin, a complex of nucleic acids and proteins, binds DNA into higher-order structures, ultimately forming a chromosome. The National Science Foundation and the National Institutes of Health are among 11 federal agencies participating in the awards. Strahl's award is associated with a five-year NIH rese...

Smac-ing back at cancer cells

...h are the cell's power plants. Once released, Smac binds to a group of gatekeeper proteins known as "inhibitor of apoptosis proteins" (IAPs), which normally hold in check the cell's chief executioner enzymes. These enzymes, called caspases, wreak lethal havoc in cells targeted for apoptosis. Smac's action ...

Common cold virus can cause polio in mice when injected into muscles

...gnature of poliovirus, a virus that recognizes and binds to the CD155 receptor. However, the mice were genetically engineered to have only the Coxsackie A21 receptor, called ICAM-1, and they did not have the poliovirus receptor. Still, when the mice were injected with Coxsackievirus, it initiated infection...

Small, Smac-like molecule encourages death of cancer cells

...d by accident. Based on information about how Smac binds to IAPs, the researchers designed molecules they thought would mimic this interaction. They prepared and screened hundreds of candidates. Smac is a large molecule and is also a dimer, which means that is it made up of two identical halves. Dr. Harran...

Diabodies act as guided missiles targeted to mammary tumor growth

... in the mammary tumor cells. "The dimeric C6.5K-A binds to its target antigen 40 times more tenaciously than its individual monomeric components, thus promoting prolonged retention in antigen-laden tumors. At the same time, its small size enables it to efficiently find and penetrate these tumors," Adams ...

Scientists discover proteins involved in spread of HIV-1 infection

...d that the yeast version of TSG101, called Vps23p, binds to two other proteins, Vps28p and Vps37p, to form ...s on one of the proteins,VPS37B, and found that it binds to TSG101 through a conserved sequence of amino acids that is also present in all of the other Vps37...

How an insidious mutation fools DNA replication

...des. "We saw that, ironically, when the polymerase binds the correct cytosine opposite 8-oxoguanine, the structure looked like DNA mispairs," said Beese. "This suggested that the enzyme would stall and not readily proceed with replication. "But when we put in an incorrect adenine nucleotide, it looked like...

New 'clock gene' uncovered

...iption factor -- a type of regulatory protein that binds to DNA and can turn gene expression on or off like the flicking of a switch. Rora, once it is turned on, activates the transcription of a gene that encodes another transcription activator known as Bmal-1, which is one of the known circadian genes. ...

Last of known genes identified in complex obesity syndrome

...w what its message is, but because we know that it binds GTP, we have some ideas of where to start looking," says Katsanis....

Bad news for pathogenic bacteria: Scientists find protein essential for bacterial survival

...ugh this narrow tunnel toward the site where ppGpp binds to the enzyme. Once here, the protein helps ppGpp stay bound to RNA polymerase. "The secondary channel seems to be the hotspot for many interactions," Artsimovitch said. "It leads straight to the active site, and presents a confined area where many...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker