Tag: "burns" at biology news

Marathoning mice could have Olympian effects on obesity

...d PPAR-delta, increases the rate at which the body burns fat. This makes PPAR-delta an exciting potential target for drugs that treat diabetes and lipid disorders. The team produced a genetically engineered mouse endowed with the activated form of PPAR-delta in its skeletal muscles. The result was a dram...

Two enzymes key to calorie-burning, Brown research shows

...The end result: Food intake is inhibited. The body burns more calories. PC1 and PC2 perform their crucial protein-cutting function not only on the chemical forerunner of TRH, but on several metabolic brain messengers, researchers say. These include insulin, the hormone that controls blood sugar. This findi...

Lehmann lovegrass won't succumb to fire

...e grasses, he said. To keep prescribed burns under control, many land managers prefer to burn grasslands in the spring, when the plants and soil have more moisture, and the temperatures are cooler. The fire's temperature could affect how well a particular type of grass responds. A...

Microscopy scans show how brain cells process energy

...e passionately debated whether the activated brain burns glucose completely to water or incompletely to lactate," said Karl A. Kasischke, M.D., lead author of the Science paper titled "Neural Activity Triggers Neuronal Oxidative Metabolism Followed by Astrocytic Glycolysis." "Our results unify existing c...

Researchers establish first molecular link between eating and aging

...tes fat mobilization in mice. A mammal generally burns the protein and carbohydrates in its food immediately; it stores fat in special cells called white adipose tissue (WAT). When it reduces its caloric intake, the WAT stops storing fat and begins releasing it for metabolism. The paper's authors learn...

Fat cell hormone causes weight loss

...ood intake, but their metabolism rose. "The animal burns off more calories, so over time loses weight, which was very fascinating because we knew that leptin caused weight loss by suppressing appetite and increasing metabolic rate," explains Ahima. "Here we have another fat hormone that can cause weight lo...

Prescribed burns can threaten pine Savannah amphibians

... U.S. depend on periodic fires, today's prescribed burns are set too often for the tremendous diversity of ...ing replaced by hardwoods, the U.S. Forest Service burns sections of South Carolina's Francis Marion National Forest every two-to-three years. While prescrib...

Coal-eating bacteria may improve methane recovery

...g the methane-recovery process. Methane gas, which burns without releasing sulfur contaminants, is becoming increasingly important as a natural gas fuel in the U.S. But the process of recovering methane, which is often trapped within porous, unrecovered or waste coal, produces large amounts of water contam...

Development of hair depends on development of the hair channel

...ogy has been useful clinically in the treatment of burns and wounds. However, cultivating hair has proven to be a far greater challenge," says Fuchs, professor and head of the Laboratory of Mammalian Cell Biology and Development at Rockefeller and a Howard Hughes Medical Institute investigator. "Part of th...

Connecticut chemist receives award for cleaner air technology

...ng fuel with compressed and heated air, which then burns and generates energy to turn the turbines. Unfortunately, nitrogen oxide gases, which contribute to global warming, are emitted during this process. Pfefferle has developed a process that uses a catalyst a substance used to speed up a chemical react...

July 4 fireworks: Why they're brighter than ever

...of the oldest forms of chemistry fireworks today burns more spectacularly than ever, brightening the sky on the Fourth of July in a kind of pyrotechnical ballet, orchestrated by modern computer programming. Why are fireworks burning brighter? In the past, the colors were produced by igniting charcoal, ...

Rainforests at risk: Where theres smoke, theres even more fire

...covers that beneath the heavy smoke of intentional burns lie unintentional out-of-control fires that are de...t isnt clear is how long it takes after the forest burns for it to recover. But its a safe bet that some of them never will....

Researchers find a molecule that improves wound repair

...A ADVISORY Annually, 1.25 million Americans suffer burns and 6.5 million experience chronic skin ulcers from diseases such as diabetes. So far, treatment options for these individuals have been limited. However, Dr. Andrew Bateman of the Research Institute of the McGill University Health Centre (MUHC) and ...

Research may take the 'anti' out of antioxidants

...l of the cells. "It's sweet," Hausinger said. "It burns off the methylation and doesn't kill itself in the process. It can work on one lesion and then move on and do it again." Methylation isn't always bad, Hausinger said, but rather is an important natural process that also occurs in human DNA. However...

Examining the healing mystery of Aloe

... used as a laxative while the pulp has been put on burns and wounds for thousands of years. Besides being used in lotions and medicines, in recent years cosmetic companies have used Aloe vera in a variety of products, especially moisturizers. ...

Stanford researcher advocates aggressive, preventive anal cancer treatment

...l dysplasia is found after a pap smear, the doctor burns the affected tissue to destroy those cells, preven... Welton takes a small sample for analysis and then burns the remaining tissue to kill potentially cancerous cells. "By doing this we avoid cancer and chemoth...

Prescribed burning: Do we really know what we're doing?

...Conservation Biology. The idea of using prescribed burns to reduce large, intenseforest fires throughout the western U.S. came from studies ofyellow pine forests in the interior West, such as northernArizona. Historically, these yellow pine forests had frequentsurface fires that resulted in an open-canopy ...

Past fire regime is key to managing chaparral fires in southern California

...that limited and strategically placed prescription burns are more cost effective. One of the most important roles for fire managers of these ecosystems may be educating land planners on the limitations of reducing fire hazards in these natural crown-fire ecosystems, said Keeley, a research ecologist with t...

APS August/September journal hot picks

...ean body mass in children who suffered from severe burns over more than 40 percent of their total body surface area. The patients were randomly placed in either a 12-week standard hospital physical rehabilitation program -- supplemented with an exercise-training program -- or at a home-based rehabilitation...

Prescribed burning may threaten ground nesting birds

...pecies such as red maples. Experimental prescribed burns are being assessed to see how well they restore an... colleagues investigated the effects of prescribed burns on forest birds in four study sites: two in the Wayne National Forest and two in the Vinton Furnace ...

1 2 3

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid