Tag: "humble" at biology news

Pea Plant Stem Growth Gene Cloned

...ngs and soon put theory into practice. From these humble beginnings, genetics and later molecular biology, evolved. "Mendel's experiments are now included in every high school biology class," said Davies....

UF Scientist Seeks Super Sea Oats

...s sites to evaluate growth," Kane said. Giving the humble sea oat a hand in protecting dunes is important, Kanesaid, because the coastline is one of the most valuable resources inFlorida. Visitors come to enjoy the coastline and, in the last 30 years,residents have increasingly crowded the coastline. "Dunes...

A Real Smart Asp: Snakes Show Surprising Ability To Learn

...t that when it comes to learning andcognition, the humble snake may be quite a bit more like humansthan anyone had imagined. David Holtzman, a neuroscientist at theUniversity of Rochester, has found that snakes have a muchgreater capacity for learning than earlier studies had indicated.His research also ind...

Should Great Apes Be Given Legal Rights?

...and monkeys". And so on, until eventually even the humble lab rat wins "human"rights. After all, dogs can form deep emotional attachments, and cats seem tohave distinct personalities. Legal rights for rats is an unlikely outcome, says philosopher PeterSinger of Monash University in Melbourne, who he...

New Areas Of High Biological Diversity Discovered

...icular biotope as a whole. By concentrating on the humble terrestrial flatworm,biologists from the Zoological Museum at Amsterdam University (UvA) havediscovered three new "hotspots" of biological diversity: New Zealand, SoutheastAustralia and Tasmania. The study formed part of the NWOs Priority Programme o...

Peering at a machine that pries DNA apart

...f different helicases in the humangenome; even the humble yeast boasts about 50 kinds. For Ellenberger, the helicase represents a step in his ultimate goal tocrystallize the entire replication fork of the bacteriophage T7, a complex offive different types of protein that copies DNA. Last year, researchers l...

Meet Conan the Bacterium

... true Hollywood fashion, the star of this epic had humble beginnings, living in cow patties and elephant dung, and coming to the attention of scientists when it refused to die in food sterilization tests. You need a microscope to see this miniature future hero listed as Deinococcus radiodurans and known to ...

Unexplained infertility -- the way forward in the fog

...Wednesday 28 June) that wise doctors should remain humble about their 'success' as they could never be certain that conception would not have happened spontaneously anyway. One in six couples worldwide experience some form of infertility problem and in about5-10% of these no apparent cause can be found. Pr...

New research animals earn their stripes

...out the great mysteries of life from the brains of humble zebrafish. Their studies are conducted at the ARC Special Research Centre for the Molecular Genetics of Development. There, Dr Michael Lardelli works with zebrafish, searching for genes expressed during the earliest stages of the brain's developme...

Suspect list shortens for maternal aggression's brain origins

...seem an unlikely or unimportant step. But even the humble mouse brain has sufficient structural and biochemical complexity to resist giving up its secrets easily, Gammie says. "By taking advantage of natural variation in aggression, our study decreased the odds of confusing aggression control mechanisms wi...

Purple potato boost for organic food industry

...s attracted experts from across Europe to admire a humble potato patch at a remote agricultural research station near Hadrian's Wall in Northumberland where the variety is being grown. While plots of most common potato varieties are wilting and disfigured from the effects of being impregnated with seven dea...

Soy protein prevents skin tumors from developing in mice, UC Berkeley researchers find

...yet another boost to the healthy reputation of the humble soybean. A study published Oct. 15 in the journal Cancer Research shows that mice with the soy protein lunasin applied to their skin had significantly lower rates of skin cancer than mice without the lunasin treatment. More than two years ago, the sa...

Virginia Tech researchers join NSF Arabidopsis 2010 Project; may help produce plants that defend themselves without pesticides

...nt to biologists, the NSF said. "By studying this humble plant in the mustard family, scientists can better understand how all sorts of living organisms behave genetically, with potentially widespread applications for agriculture, medicine, and energy," the NSF press release said. Arabidopsis is a useful m...

Crayfish robots on Mars

Australian scientists are using a humble indigenous freshwater crayfish, known as the Yabby, as their inspiration to help build miniature robots for NASA's exploration of Mars. Platoons of robo-yabbies could soon explore the red planet searching for water or conducting chemical analysis of ...

Unwanted HRT playing havoc with songbirds

...vironment. Now nightingales, skylarks and even the humble sparrow seem to be at risk. Researchers have found that such chemicals interfere with songbirds' reproduction. They also alter their brains, making females sing when they shouldn't. "This is very significant," says David Crews, an expert on the eff...

Sea squirt DNA sheds light on vertebrate evolution

...neral. "We have known for years that despite their humble appearance, sea squirts, or ascidians, have a number of physical characteristics that are similar to vertebrates," said JGI Director Eddy Rubin. "Through a comparison of their genomes, we can now understand how these relationships are reflected at th...

Meanwhile, back to barnacles...

...metimes even more frequently. We're talking the humble barnacle. Historically, everything from pitch to pesticides has been used, but nothing seems to repel completely this lowly, but determined crusty fouler. Now consider the sleek, smooth dolphin, which can spend its entire life in the water and neve...

American Physical Society March Meeting 2003

...ll describe how he took his fledgling company from humble beginnings to one of the country's 500 fastest-growing private companies....

2 Million of yeast to triple available drug treatments

Researchers are to employ the humble yeast cell to greatly increase perhaps even triple - the number of drug treatments for common diseases such as allergies, asthma, obesity, type 2 diabetes, schizophrenia, heart disease, osteoporosis and cancer. Professor John Davey of the Department...

An unexplored genomic terrain in a handful of dirt

... a tuberculosis sanitarium in India. Despite their humble surroundings, the phages may have quite a story to tell. "Phages represent the most abundant life form in the biosphere, with an estimated 1031 phage particles in the world," said Hatfull. "Our data indicate not only that this amazingly diverse popul...

1 2

(Date:8/29/2014)... Los Angeles, CA (PRWEB) August 29, 2014 ... between good and bad fat. Brown fat is usually stored ... neck, while white fat typically reveals itself in overflowing bellies, ... While good fats occur naturally in many foods and promote ... negative health risks, including elevated bad cholesterol levels and lower ...
(Date:8/29/2014)... 2014 Princeview Dental ( http://www.princeviewdental.com ), ... expert opinion on the most effective oral care for ... practices and routines that are necessary for proper oral ... Dr. Janice Mummery, Founder of Princeview Dental. “Not too ... day is still important, as is using the proper ...
(Date:8/29/2014)... August 29, 2014 Edvance360, a leading ... tools for online teaching, as well as 2011 winner ... or Learning Management System, announced that their CTO, Brian ... in the ALS Ice Bucket Challenge on behalf of ... Sanders, Edvance360 Co-Founder. , “We know that the options ...
(Date:8/29/2014)... ACCA Clinical Decision-Making Toolkit mobile app is now ... , When dealing with acute cardiovascular diseases, a ... access to the best recommendations can save lives. ... of the ESC to develop a user friendly ... to diagnostics pathways on their mobile devices. , ...
(Date:8/29/2014)... these recent findings, there has been a significant rise in ... few years. Medical expert and Herpes researcher, Dr. Williams said, ... that make it hard for patients to find out if ... the exact symptoms of these ailments, others confuse it with ... of cases over the years has been a cause of ...
Breaking Medicine News(10 mins):Health News:Diet Doc Announces Modernized, Interesting and Easy to Follow Diet Plans that Deliver Fast Weight Loss and Teach Patients the Difference Between Good and Bad Fat 2Health News:Diet Doc Announces Modernized, Interesting and Easy to Follow Diet Plans that Deliver Fast Weight Loss and Teach Patients the Difference Between Good and Bad Fat 3Health News:Princeview Dental, One of Etobicoke’s Trusted Dental Clinics, Announces the Best Tooth Brushing Practices for Kids 2Health News:Edvance360 Participates In the ALS Ice Bucket Challenge (#ALSicebucketchallenge) 2Health News:Mobile app on emergency cardiac care aids best decisions in seconds 2Health News:Mobile app on emergency cardiac care aids best decisions in seconds 3Health News:It was reported that the Number on PositiveSingles.dating increased about 20% in 2014 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes