Tag: "modern" at biology news

Climate change plus human pressure caused large mammal extinctions in late Pleistocene

...But it's possible, Barnosky said, that the rise of modern humans - Homo sapiens sapiens - with their broad variety of tools and diverse diet, negatively impacted these animals to an extent not seen in Europe with earlier human species, such as Homo erectus and Neanderthals. North America, in particular, is ...

Veterinary Memorial Fund transforms grief into promise

...ojects have funded projects across the spectrum of modern clinical veterinary medicine, from ophthalmology to orthopedics, from new anti-inflammatory drugs to improved surgical procedures. Virginia Veterinary Medical Association practitioners make most of the donations to the fund, and they play a ...

Conference at UH opens doors for new scientists, engineers

...enter of Houston and associate professor in the UH modern and classical languages department; and Richard A. Tapia, the Noah Harding Professor of Computational and Applied Mathematics at Rice University. Borras has made significant contributions in science, engineering and technology by leading the ...

Grant advances biochemical engineering laboratory

...ng biochemical engineering laboratory will include modern biology benches and cabinetry, new flooring and a new biological hood. The renovations will provide a clean, low-contaminant environment for the transfer of microbial cultures in student fermentation experiments. The grant also will be used to acquir...

Genes expose secrets of sex on the side

...n a culturally accepted fashion, Wilder said. "The modern version that we generally don't find offensive is that men tend to remarry and have more children much more often than women do." The team's research also overturns the long-accepted idea that, on average, women's genes traveled farther from th...

New research suggests early diet may play key role in protecting against childhood leukaemia

...es of leukaemia in children are poorly understood, modern environmental and lifestyle factors are thought to play a major role in the rising incidence. If this is the case, it should be possible to take preventive measures. But first we need to identify the factors responsible. This is the motivation behin...

Adaptive changes in the genome may provide insight into the genetics of complex disease

... such as diabetesand obesity. "The environment of modern humans is dramatically different compared to ourancestors who lived just 10,000 years ago. Now we have unlimited access tofast food and super-sized versions of everything. Although the "thrifty genehypothesis" may be overly simplistic, the basic idea...

Complex cells likely arose from combination of bacterial and extreme-microbe genomes

...ations that reflected the most likely ancestors of modern eukaryotes. Their analysis, they say, showed that... out cellular processes. According to the report, modern eukaryotes obtained genes required to operate the cell from the bacterial side of the family, and th...

Rising childhood leukaemia incidence prompts conference

...cing today's children is at least partly caused by modern lifestyle factors, as is suggested by the increasing incidence, then it may be possible to take some preventive measures. But, first we need to determine what these factors are." The conference, which will include many presentations of new data, will...

Recent evolution at a single gene may have brought down heart disease risk in some human groups

...e that the incidence of heart disease events among modern European males would have been more than 40% higher than it is had there not been selection for the high-expression variant. The cause of the selection in recent evolution remains a subject for speculation; given its usual occurrence late in life, he...

Broken arms and collateral damage: clues to predator-driven evolution

...e capable of regenerating lost body parts. Because modern day crinoids usually lose---and regenerate---their arms as a result of attacks by fish, Baumiller and Gahn reasoned that arm regeneration in fossil crinoids would be a good indicator of predator-prey interactions in the geologic past. To test their i...

Entrepreneurs to be told how nature's secrets can improve business

...opportunities out there into something relevant to modern industry. We invite people to come and break through a challenge in their industry or research area with us." The workshop will be led by Professor Julian Vincent, head of the Centre. Dr Olga Bogatyreva, and Dr Nicolai Bogatyrev, Russian ...

Analysis of biological clock may lead to greater understanding of human disease

...s in molecular biology, viewed through the lens of modern systems analysis, is now supplying biological systems engineers, such as this collaborative team, with the ingredients to understand and explain biological and physiological functionality in an unprecedented, comprehensive way," said Dean Matthew Tir...

One-hundred-fifty year old lessons of John Snow still relevant today

...waterborne agent that could strike anyone was very modern in a time when most people and physicians tended to make distinctions along class lines." Most of the book focuses on the later years of Snow's short life he died in 1858 at the age of 45 partly because very little is known of his early days. Howev...

APS showcases 46 historic breakthrough research articles

...a deeper understanding of the cultural heritage of modern day science. The Classic articles, introductory essays, and complete first editions of each journal are freely available on the APS Journals web site ( http://www.the-aps.org/publications/classics/ )....

Improving crops without genetic modification natural variation holds the key

...trategy. Their hybrid model--applying the tools of modern genomics to traditional plant breeding--offers plant breeders a powerful approach to improving the quality and yield of cultivated plants by taking advantage of the inherent biodiversity of the natural world. It's a strategy that may well apply to ri...

Why your knees and quads hurt more after running than walking: You're only human

...t bipedal gait within hominids which distinguishes modern humans from avian bipeds and mammalian quadrupeds."...

Scientists reinvent DNA as template to produce organic molecules

...ared with the structures that can be created using modern synthetic chemistry, and yet this very modest set of protein and nucleic acid building blocks has given rise to the incredible complexity and diversity of living systems," says David R. Liu, associate professor of chemistry and chemical biology at Ha...

Shedding new light on biology

...logy will undoubtedly become a standard fixture in modern biology labs. Its many advantages and applications are described in the latest edition of Science (Aug 13, 2004). Called SPIM (Selective Plane Illumination Microscopy), the technology allows scientists, for the first time, to study live systems fro...

Evolution of whale hearing unfolds in fossil record

... scientists has traced the evolution of hearing in modern cetaceans (whales, dolphins and porpoises). "Thi...re . The ear is the most important sense organ for modern toothed whales, say scientists, because these whales locate their prey using echolocation. Directio...

1 2 3 4 5 6 7 8 9 10

(Date:7/3/2015)... ... ... Celebrity Dresses is currently running a promotion through July 30th. Anyone who orders party ... get 10% discount on orders that are over $100. , The promotion is automatically ... or remember redemption codes. , There is a low price guarantee at The ...
(Date:7/2/2015)... ... July 02, 2015 , ... Following the recent report by ... obese Americans outnumber merely overweight Americans, Samir Becic emphatically declared a war on obesity ... society right now," Becic said. "We must understand the magnitude of this discovery. For ...
(Date:7/2/2015)... ... ... With summer in full swing, Americans are flocking to Canada’s many lakes to reel in ... in the world, and it’s easy to understand why. From the Pacific Northwest Coast of ... Recreational fishing is a huge industry, and Americans make up the vast majority of anglers ...
(Date:7/2/2015)... (PRWEB) , ... July 02, 2015 , ... ... the newest shades of the SIGVARIS PERFORMANCE SOCKS. Since the socks were first ... and athletic trainers. Their significant popularity has inspired four new, fun shades including: ...
(Date:7/2/2015)... ... , ... ActiveBunch.com recently launched as a social network created for people with ... lifestyle community, Active Bunch allows users to connect with like-minded fitness enthusiasts from around ... or group events. , The spokesperson for Active Bunch explained the idea behind ...
Breaking Medicine News(10 mins):Health News:Celebrity Fashion Summer Party Dresses on sale at TheCelebrityDresses.com 2Health News:Samir Becic's Health Fitness Revolution Declares War Against Obesity in America 2Health News:Samir Becic's Health Fitness Revolution Declares War Against Obesity in America 3Health News:Samir Becic's Health Fitness Revolution Declares War Against Obesity in America 4Health News:SIGVARIS is Sporting Four Brand New Colors in the Popular PERFORMANCE SOCK Product Line 2Health News:ActiveBunch.com Launches as a Social Community for People with Active Lifestyles 2
Other Tags
pushapplyingpackagesmachineslevelatomicantibioticswatchpentoxifyllinecrohnsremissionsprolongnewbornslevelemorymechanism