Tag: "press" at biology news

Cancer vaccine based on pathogenic listeria bacteria shows promise targeting metastases

...vel cancer antigens, according to a recent company press release. Cerus is collaborating with Johns Hopkins University to develop a listeria-based vaccine targeting pancreatic and ovarian cancers that express the Mesothelin antigen, and has partnered with MedImmune, Inc., to develop a listeria-based vaccin...

16 APS exercise research highlights, from reduced flu mortality to proteomics & obesity

...ximal mobilization in the concentric part of a leg press device improves work economy in COPD patients. 23.5 Stan L. Lindstedt, et al. (Northern Arizona University, Flagstaff) Design of muscle for function as a spring. Titin may function as a major component in the vertebrate muscle spring and the "spri...

Agronomy, crop, and soil science societies to meet Oct. 31 to Nov. 4 in Seattle

... interviews with Annual Meeting presenters, and/or press releases of the sessions, contact Sara Uttech 608-268-4948. Also available to members of the media/public information officers is online access to the Annual Meetings' abstracts. To receive your name and password to access this searchable resource, c...

Snakehead in your inbox? Welcome to the nonindigenous Aquatic Species Alert System

...notated with extra information such as a link to a press release about the capture or an identification page."...

Final Alert: 16th EORTC NCI AACR Symposium

...Free registration to bona fide media with official press credentials Media centre with free computing, fax...Please note: information above on news briefing & press release topics is for information only and is embargoed until the time of the news briefings or pres...

Rising childhood leukaemia incidence prompts conference

...rence are open to the media and there is a staffed press office. A news briefing will be held at 10.30am for 10.45am Monday 6 September in the Charter Room. The speakers will be: Professor Denis Henshaw: (Conference chairman) What's new at the conference a preview Mr Eddie O' Gorman: (Chairman of CHIL...

Homeland security initiative takes Memphis' ORNL technologies to the nation

.... Other DHS sites are Cincinnati and Anaheim. In press statements about the program, Homeland Security Under Secretary for Science and Technology Charles McQueary said selected locations will provide an environment for advanced security technologies and provide data on how best to choose, deploy, and man...

2nd media alert First Scientific Conference on Childhood Leukaemia

...ee for bona fide media on presentation of official press credentials at the conference press office....

Possible new cure for psoriasis

This press release is also available in German . Cell biologists of the University of Bonn, in cooperation with the University of Leeds (U.K.) and industry may have discovered a new effective therapy for psoriasis: a specific group of what are known as metal...

T. rex owes its giant size to the ultimate teenage growth spurt

...ickson will present their findings at a 12:00 noon press conference on Aug. 11 at The Field Museum in front of Sue, the world's largest, most complete and best preserved T. rex fossil. [Free parking for the media will be available in The Museum's west lot, immediately adjacent to the building.] Seven milli...

First International Scientific Conference on Childhood Leukaemia

...ee for bona fide media on presentation of official press credentials at the conference press office or by pre-registering. You are welcome to attend all sessions. A news briefing will be held o...

UAB creates the first Internet server to search for genetic diversity

This press release is also available in <A HREF="http://www.eurekalert.org/staticrel.php?view=uadbuct071904sp">Spanish . Researchers from the Universitat Autnoma de Barcelona have developed the first international server that allows the user to analyz...

16th EORTC NCI AACR Symposium

...ion is free to bona fide media presenting official press credentials, or a letter from the editor of the jo...icial language of the symposium is English and all press materials will be in English. To register: contact Margaret Willson for a registration form or do...

Key principles for the foundation of a European Research Council (ERC)

...e EUROHORCs may be found in the attachment to this press release....

American Chemical Society media registration

...n/index.cfm?PressReleaseID=2362&categoryid=21 The press room -- Room 303 of the Pennsylvania Convention Ce.... until 5 p.m. except Thursday, August 26 when the press room will operate only from 8 a.m. until noon. Media may register in advance. At registration pickup...

JCI table of contents, 1 July 2004

This press release contains summaries of newsworthy papers to be published online on 1 July 2004, in the Journal of Clinical Investigation including: A Pregnant Pause for Unexpected Interactions; Half at the Wrong Time Creates Bad Blood; Cancer Patient, Heal...

Mice with hyperactive Wnt10b gene eat all they want, but have half the body fat of normal mice

... "JBC Online" Web site (see URL at the end of this press release). "To determine the effect of the gene on adipose tissue development, we created an artificial sequence of DNA called a transgene linking Wnt10b to another gene called the FABP4 promoter, which is expressed only in adipose tissue," Longo says...

Carnegie Mellon U. imaging study reveals sex-based differences that persist as mice enter adulthood

...or emotions, learning, and memory. The results, in press with NeuroImage, show that sex hormones alter the development of certain brain structures during puberty and that these effects persist into adulthood. The findings provide a much truer representation of how circulating hormones affect brain stru...

Open Access journals proven to compete on quality

...nals and traditional subscription products. In the press release announcing the April version of the report, ISI stated "journals published in the new Open Access (OA) model are beginning to register impact in the world of scholarly research". The statement continues "Using ISI citation metrics such as imp...

New public policy & aging report highlights facts and fiction about anti-aging medicine

...Gerontological Society of America are co-hosting a press briefing in New York City to coincide with the release of special sections in the June and July issues of The Journal of Gerontology: Biological Sciences. This month's The Gerontologist also features an article - based on research funded by the Natio...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... 2013 Spring is the perfect time ... markets filled with whole foods to weather perfect for ... the season the nutrition experts at Brilliant Nutrition highlight ... miss. , 1. Eating Locally, With the abundance of ... linger and explore, spring is a great time to ...
(Date:5/21/2013)... George Washington (GW) University School of Public ... launch of the Avance Center for the ... SPHHS, the Maryland Multicultural Youth Centers, the ... university-community partnership aims to address public health ... research, mutual capacity building and prevention efforts. ...
(Date:5/21/2013)... Parker Waichman LLP, a national law firm dedicated ... devices, is offering remarks on the closing argument of the ... E. Taylor v. Intuitive Surgical, 09-2-03136-5, Superior Court, State of ... Bloomberg report noted that the plaintiff’s attorney, after noting ... how it deployed its strategy to train doctors to use ...
(Date:5/21/2013)... Charlotte, NC (PRWEB) May 21, 2013 ... Greater Charlotte will hold a free Community Wellness Fair ... screenings. The fair will be held on Wednesday, May ... University City YMCA (8100 Old Mallard Creek Road, ... American Heart Association and the Mecklenburg County ...
(Date:5/21/2013)... 21, 2013 Arizona State University ... want to develop their ideas into solutions, products ... , The university is recruiting participants for AREA48 ... space” that provides early-stage entrepreneurs with opportunities to ... open to anyone, ASU is particularly seeking participation ...
Breaking Medicine News(10 mins):Health News:Brilliant Nutrition Offers 5 Ways to Live Healthier and Inspired this Spring 2Health News:Brilliant Nutrition Offers 5 Ways to Live Healthier and Inspired this Spring 3Health News:GW launches center to address health disparities in the Latino immigrant community 2Health News:GW launches center to address health disparities in the Latino immigrant community 3Health News:Da Vinci Robotic Surgery Lawsuit: Parker Waichman LLP Reacts to Plaintiff’s Attorney’s Closing Argument in Which He Describes Intuitive Surgical as a Car Dealership 2Health News:Da Vinci Robotic Surgery Lawsuit: Parker Waichman LLP Reacts to Plaintiff’s Attorney’s Closing Argument in Which He Describes Intuitive Surgical as a Car Dealership 3Health News:Mecklenburg EMS Agency Teams Up with the YMCA of Greater Charlotte and Others to Educate the Public on Health Related Initiatives 2Health News:ASU Launches Summer Program for Aspiring Entrepreneurs, Innovators and Inventors 2Health News:ASU Launches Summer Program for Aspiring Entrepreneurs, Innovators and Inventors 3Health News:ASU Launches Summer Program for Aspiring Entrepreneurs, Innovators and Inventors 4
Other Tags
confidentialitydisorderspsychiatricfindingtakecampaignsmediaasmsubarachnoidfetusesantherosclerosisathleticismzincinsertssalediscourages