Tag: "prevention" at biology news

Second Breast Cancer Gene Located

...discovery to use as we developbetter therapies and prevention strategies to protect all women from thisdisease." Dr. Eric Winer, the co-director of Duke's multidisciplinary breast program,said the localization of BRCA2 "paves the way for genetic testing forboth BRCA1 and BRCA2." While BRCA1 testing i...

Selenium Supplements Can Reduce Cancer Rates

... the first double-blind, placebo-controlled cancer prevention study with humans that directly supports the thesis that a nutritional supplement of selenium, as a single agent, can reduce the risk of cancer," said Gerald F. Combs Jr., a nutritional biochemist and Cornell professor of nutritional sciences. Combs ...

Blood Test Can Identify Some Children With Strep-Related Behavioral Disorders

...th strep throat. This allows clinicians toconsider prevention of the abrupt appearance of OCD and tic disorders, shesaid. "If we could potentially screen children at risk when they're young, wecould watch the children who have this trait marker for rheumatic fever moreclosely and catch them right away if they...

Hunt For Early Heart Attack Genes Begins

... provide a scientific basis for disease detection, prevention andtreatment. This special hospital environment served as the model for the WarrenG. Magnuson Clinical Center, opened at the National Institutes of Health in1953, and similar facilities supported by federal funding at more than 75medical schools in ...

Plant-Based Therapies Examined For Colon Cancer Prevention

...o provide ascientific basis for disease detection, prevention and treatment. This specialhospital environment served as the model for the Warren G. Magnuson ClinicalCenter, opened at the NIH in 1953, and similar facilities supported by federalfunding at more than 75 medical schools in the United States. ...

New Mechanism To Explain Carbon Monoxide Poisoning Identified

...ensitivity to the need to be more aggressive about prevention and treatment ofcarbon-monoxide exposure." This study was supported by a grant from the National Institute ofEnvironmental Health Sciences and a contract from the Health Effects Institute....

Report Notes Difficulties In Eliminating E. Coli O157:H7 From Food Supply

...ion with the diseaseseverity means that successful prevention strategies must focus on reducing oreliminating the presence of the microorganism, rather than on preventingpathogen growth as is done in more traditional approaches," Buchanan and Doylewrote. The Hazard Analysis and Critical Control Point (HACCP) sy...

Guidelines For Next Generation Of Environmental Policy

... do what national governments will not: underwrite prevention and control of transboundary pollution. "This would mean, for example, that the World Bank would help theChinese build high-efficiency electric generating stations with appropriatesmokestack controls to replace polluting coal power plants," ...

'Suicide Response' Gives Colorado State Researchers Important Clues On Preventing Bacterial Invasion In Crops Worldwide

...atoes, adisease that spawns millions of dollars in prevention and treatment costs onAmerican farms each year. A single plant with symptoms of ring rot infection ina field of potatoes can cost a farmer as much as $80,000 in lost revenue.Because ring rot spreads so quickly and potato plants have zero tolerance fo...

ACS Aids Cornell Vet School Cancer Research

...nell, the society provides educational programs on prevention and early detection as well as support to cancer patients and their families. For more information about programs and services available, call 1-800-ACS-2345....

NIAID Doctor Successfully Treats Longest Case Of Malaria Infection On Record

...o determine whether or not vaccine and prevention campaigns have really eradicated malaria," comments Dr. Vinetz. Dr. Vinetz co-authors on the paper include Jun Li, M.D., Ph.D., Thomas F. McCutchan, Ph.D., and David C. Kaslow, M.D., all of NIAIDs Laboratory of...

Short-Course TB Prophylaxis Effective In HIV-Infected Individuals

... presented preliminary results of the short-course prevention study last week at the 5th Conference ...en could greatly reduce the cost of TB prevention programs," adds Dr. Gordin, who notes that personnel and administrative costs make runni...

Sexually Active Younger Women Are At Higher Risk For Infection With Human Papillomavirus

...herapeuticvaccines would play an important role in prevention and control." Higher risk and incidence of HPV infection are associated with younger age,ethnic minority subgroups, increased frequency of alcohol consumption, anal sexor a high frequency of vaginal sex. A woman was less likely to have an HPVinfecti...

Age-Based Screening Is Cost-Effective Method To Control Chlamydial Infection

...ve diagnostic test should bepart of any chlamydial prevention and control program. NIAID has a major commitment to develop new sexually transmitted disease (STD)diagnostic tests that are rapid, inexpensive, easy-to-use and do not require an invasive sample. If such tests were available andacceptable to the pa...

U.S. Scientists Honored For Lifetime Contributions In Hepatitis Research

..."profound effect on the control and prevention of various forms of hepatitis." "Our studies have taught us," said Dr. Purcell, "that while cultures may differ from region to region, diseases and the suffering they cause ...

Studies Underscore Link Between Nutrition And Nonmelanoma Skin Cancers

...considered the major cause of most skincancers, so prevention has focused on staying out of the sun and wearingprotective clothing and sunscreen. But studies in recent years have indicated that several nutritionalfactors also may play a role, according to Harvey Arbesman, M.D., adermatologist and Univ...

Sex Differences In Heart Disease May Be Due To Enzyme That Breaks Down Fat

... the American Heart Association's epidemiology and prevention conference. "There are gender differences in the risk of coronary artery disease,the cause of heart attack. Pre-menopausal women have lower cholesterol levelsand higher HDL levels (the good cholesterol) and lower heart disease rates thanmen,...

Genetic Make-Up May Determine Response To Cholesterol-Lowering Drugs

...t the American Heart Association's epidemiologyand prevention conference today. "Not everyone benefits from lipid-lowering drugs. There are geneticvariations that appear to make some individuals more responsive and others lessresponsive," says Maren Scheuner, M.D., M.P.H., director of GenRISK, a clinic...

American Museum Of Natural History Holds Symposium On Biodiversity And Human Health Issues

...of Species to Medical Research Research into the prevention and treatment of human diseases - many of themcurrently untreatable - through study of various species. Topics include: Battling tumors in humans by uncovering information about the immune systemsof sharks. Developing possible treatments for os...

New Test Opens Window On Corrosive Free-Radical Activity In Individuals

.... "Canantioxidants contribute significantly to the prevention or treatment of disease?This new test will allow us to answer these and other important questions aboutfree-radical activity in individuals." To date, the evidence linking free radicals to disease and aging --through a biochemical process ana...

1 2 3 4 5 6 7 8 9 10

(Date:6/18/2013)... "What if adding one simple act ... your health and well-being? Well, there is something easy ... "It is called Skin Brushing ." , Skin ... lost art. Now, people are rediscovering this great health ... so do certain health conscious people. Sublime Beauty® wants ...
(Date:6/18/2013)... New York, New York (PRWEB) June 19, 2013 ... dedicated to protecting the rights of victims injured by ... on behalf of an Arizona woman who alleges that ... The suit was filed on May 30th in the ... Virginia (Civil Action No. 2:13-cv-12677) in the multidistrict litigation ...
(Date:6/18/2013)... Looking for a way to break out of the ... IWALKAWAKE is a guide to unlocking one’s true potential through ... on harnessing the powerful and abundant spiritual presence that is ... guide to finding one’s true purpose and potential. These nine ... to reach their true potential. The awakenings deal with subjects ...
(Date:6/18/2013)... Daily Gossip Magazine has always kept its readers entertained by ... The magazine has decided to prepare readers for the summer ... every week . , According to Daily Gossip ... who are looking to get insights into this type of ... food is almost entirely based on healthy, yet tasteful products. ...
(Date:6/18/2013)... 18, 2013 SEATTLE, WA—A Washington state ... Fairview, Oregon, claiming he fell ill with a hepatitis ... pomegranate seed blend. The complaint was filed in ... Clark, the Seattle-based law firm that has filed ... to the complaint, Brian Brothers consumed “Townsend Farms Organic ...
Breaking Medicine News(10 mins):Health News:The Easiest Way to Contribute to Better Health and Well-Being Starting Today and for Under $20, Says Sublime Beauty® 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 3Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 4Health News:Anabolic Cooking Book Review Exposes Dave Ruel’s Top 10 ‘Anabolicious’ Recipes for BodyBuilders 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 3
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma