Tag: "site" at biology news

Duke Researchers Discover Central Role Of Nitric Oxide In Hemoglobin Action

...ch include a centraliron molecule that serves as a site on which to bind and carry oxygen. Thesame site also destroys "free" NO. Stamler and his team foundthe "new" NO attaches itself to the hemoglobin-o...

Enzyme's "Magic" May Hold Key to Anticancer and Antimicrobial Drugs

..., DNA enters and exits the enzyme's active site through the same "gate." According to the "two-gate" theory, DNA enters by one "gate" and exits, after the reaction, by a different "gate." The PNAS paper supports the "two-gate" theory. The researchers used two ap...

New 'Twist' In Proteins Offers Possible Route To Improved Antibiotics

...derickis currently attempting to locate the active site by determining the X-raystructure of the enzyme with one of its bound substrates. In a first step toward developing antibiotics that would block the enzyme'sactivity, the Duke scientists also are planning to survey known chemicalsthat might f...

Duke Geologists Explore Alternative Way To Measure Ice Age Sea Bottom Temperatures

... ostracod samples from a Deep Sea Drilling Project site just west of the mid-ocean ridge at roughly the same latitude as New Jersey. That is a location where deep sea circulation patterns are thought to shift markedly between glacial and interglacial periods. The ostracod in the samples were alive between...

New Discovery About Genes Has Implications For Genetic Therapy

... This ability of the introns to pick and choose a site along the gene where they would insert themselves convinced the researchers that they were seeing a holdover to a similar mechanism that must have taken place in the earliest evolutionary stages of primitive one-celled animals-- at least a billion ye...

Mutate Or Die: New Polymerase Gives Desperate Yeast An Option

... the organism. "Replicating past the damaged site is the leastfavored mechanism of dealing with DNA damage, but from the cell's perspective, it's better to replicate damaged DNA andsurvive than to not replicate and die," says Christopher Lawrence, professor of biophysics. Working with Lawrence on th...

Cornell Researchers Precisely Date Wood From Ancient Tomb In Turkey

...exact year that logs were cut at an archaeological site in Turkey, a finding that has major implications f... in juniper, cedar and pine samples from Porsuk, a site in central Turkey, that were three to eight times wider than normal. Porsuk is about 840 kilometers...

Water Recycling Project Tested in Turkey Plant

...turkey processing plant in Springdale,Ark., is the site of the procedure that has been developed with Food SafetyConsortium researchers at the University of Arkansas and engineers at AmericanWater Purification, Inc., of Wichita, Kan. Water is used to chill turkeycarcasses at the plants. Chill water quickl...

Hawaiian Whales Show 'No Overt Response' To Sounds Of ATOC Simulation

...sions at Pioneer Seamount, the California coastal site for the other ATOC speaker, also found no sign of disturbance among marine mammals, including elephant seals and several whale species. Full operation of the controversial ATOC experiment is subject to approval of the National Marine Fisheries S...

Duke Ecologist Says Logging Is Creating 'Mahogany Deserts'

...ood through the photosyntheticprocess. At a study site in Belize as well as in Mexico, Snook is dropping mahoganyseeds onto cornfields to see if the species can also be regenerated andmanaged in conjunction with shifting agriculture. "I'm sure that's what happened in the past," she said. "Notonly did ma...

North America Hit Hard By Asteroid Strike In Yucatan 65 Million Years Ago

...plants are regarded as key flora in colonizing the site of anatural disaster. Plants in parts of the world not downrange from the impact took a lesser hitfrom the corridor of incineration. For example, several ancient evergreen treesfound in North America before the impact, but not after, still grow in p...

Genetic Makeup May Explain Why Some Women Smokers Develop Breast Cancer While Others Don't, UB Study in JAMA Reports

... this disease," she added. "It is one more cancer site in which cigarette smoking has been implicated." Earlier studies showed that smokers with the slow-acetylation genotype for NAT2 had higher levels of tobacco's carcinogenic compounds in their bloodstream, and were at higher risk of developing bladde...

Medicinal Leech May Offer Clues To Neural Regeneration

...dy shows that NOS in the leech is activated at the site of injury within minutes after axons are severed, ...d cells. By flagging down microglia to help at the site of injury, nitric oxide may aid efforts to minimize tissue damage and infection. Sahley is pursuing ...

Cornell Scientists Find Way To Boost Rice Crop Yield -- They'll Walk On The Wild Side

...t the world can tap into a Cornell information Web site and use that mapping data to boost rice production in their parts of the world. McCouch said that although the wild species are generally useless for crop production -- since they do not produce much rice, have very small grains, and the plant tends...

Recruiting Mole-Rats

...odents would rather recruit family members to the site of food they found than eat the food themselves. The biologists watched and listened through transparent laboratory burrows as one mole-rat after another took an altruism test that many humans would fail. In various sites in a plastic tunnel maze,...

Christmas Bird Count: Another Holiday Tradition

...e U.S. and Canada for the past 30 years. Visit the site at: http://www.mbr.nbs.gov/bbs/cbc.html And when others are stuck with a mere partridge in a pear tree, you can sing about significant increases among eastern bluebirds, American crows, and American goldfinches and declines of bobwhites, lo...

A Sensor, A Switch, A Zipper: Protein Engineers Design Potential Tool

...he design incorporated a selective binding site such that when the researchers added a small molecule, benzene, the two helices intertwined with a third to create a triple-helical coiled coil. This structural change could enable the protein to indicate the presenc...

ORNL Microscope "Sees" Bumps That Reveal Partial DNA Structure

...hen a proteinrecognizes and attaches to a specific site on a DNA molecule. These ORNL scientists are developing this new imaging approach as analternative technology for DNA mapping. They think their technique will bemore accurate and perhaps faster than conventional methods. DNA, sometimes referred to as...

Penn State Wetlands Project Seeks Scientific Evaluation Criteria

...aracteristics of a certain type of wetland to the site where you intend to replace or restore a wetland." The project identified 51 sites as reference wetlands and categorized them into types, such as riparian depressions,headwater floodplains, mainstem floodplains, and slope wetlands. At each indiv...

Scientists Determine 3-D Crystal Structure Of Cancer-Causing Protein

... the SH2 domain appearsto be to set up the binding site on the enzyme's catalytic machinery for properbinding of the SH3 domain," said Kuriyan. In a companion paper in the same issue of Nature , Kuriyan, Sicheri andMoarefi collaborated with researchers Michelle LaFevre-Bernt, B.S., and W. ToddMil...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement