Tag: "sudden" at biology news

New study shows hope for treating inhalant abuse

...kidney, and brain damage -- and can even result in sudden death. The Brookhaven Lab study demonstrates that animals previously trained to expect toluene in a given location spent far less time "seeking" toluene in that location after being treated with GVG than animals treated with a placebo. This elimin...

Cannabis may help combat cancer-causing herpes viruses

...by virologist Peter Medveczky, MD, found that this sudden reactivation was prevented if infected cells were grown in the presence of THC. While cells infected with a mouse gamma herpes virus normally died when the virus was reactivated, these same cells survived when cultured in the laboratory along with th...

Serotonin metabolites in mollusks suggest pathways for human therapies

...to occur in disorders such as depression, anxiety, sudden infant death syndrome, attention deficit hyperactivity disorder and irritable bowel syndrome. Many pharmaceutical treatments restore the pathways by preventing the cellular uptake of serotonin, where it is converted to other metabolites, or by direc...

Wrapping a memory with an experience, capacity for recollection detected in non-human species

...rceived, from those triggered by recollection, the sudden rush of detailed memory. The BU team chose to determine whether analyses related to this technique, known as receiver operating characteristic (ROC) curves, could be used to assess rat memory processes. With familiarity, previous encounters are not...

Broken arms and collateral damage: clues to predator-driven evolution

...e Paleozoic Marine Revolution and then there was a sudden increase, coincident with the diversification of predators and the increase in the evolutionary response of the prey," Baumiller said. That's not the whole story, though. Baumiller and Gahn suspect that crinoids were not the intended targets of the p...

Humans march to a faster genetic 'drummer' than primates, UC Riverside research says

...erstood sections of DNA are volatile, and prone to sudden mutations, or genomic rearrangements. At times the results are beneficial in that they give rise to new proteins or an altered gene regulation. Sometimes the mutations result in the growth of a cancer tumor, or some other genetic defect. The team, w...

University of Arizona licenses patent for natural fungicide

...o famine. Zoosporic plant pathogens also cause the sudden oak death affecting oak trees in California and Europe. In the spring of 2004, Jeneil obtained U.S. Environmental Protection Agency approval to use a rhamnolipid product as a fungicide, said the company's president, N. R. Gandhi. Any revenue that the...

Heartless worms hold clues to cardiac arrhythmias, sudden death

...tool could lead to ways to prevent arrhythmias and sudden death associated with block of a potassium channel called HERG (Human ether-a-go-go related gene). Many therapeutic drugs -- antihistamines, antidepressants, antibiotics -- block HERG, Petersen said. This undesired blockade can cause acquired long Q...

New understanding of the machinery of flinching

...et of stimuli--in this case those that represent a sudden approach of objects to the body. "PZ may provide an example in the motor system of a relative hotspot for the ethologically important function of defense of the body surface, although PZ may of course have other sensory and motor functions not tested...

Embryonic stem cell therapy shows steady benefits in rebuilding infarcted heart

...jection, electrical and/or structural abnormality, sudden cardiac death or tumor formation. Conclusion and next steps The researchers conclude that "embryonic stem cells, through differentiation within the host myocardium, can contribute to a stable beneficial outcome on contractile function and ventricul...

Infants sighs may 'reset' breathing regulation mechanism as well as help lungs develop

...evere form, this may be seen in conditions such as sudden infant death syndrome (SIDS). Researchers in Switzerland, Australia seek to find control center implications Researchers at the University Children's Hospital in Bern, Switzerland, and in Perth, Australia, wanted to know if in addition to ...

Why some neonates need caffeine

...ply can alter respiratory behavior and can lead to sudden death. Only one study has dealt with sleeping neonates: it showed that increased oxygen in the tissues and organs induces a greater decrease in ventilation after ingestion of aminophylline (10 mg/kg). This study was performed in infants who did not ...

Researchers identify gene for a primary form of sudden infant death sydrome (SIDS)

...ania, have found the genetic basis for one form of sudden infant death syndrome (SIDS). The researchers have named the newly described form as sudden infant death with dysgenesis of testes, or SIDDT. The finding, released this week on-line by the jou...

Molecular motor shuttles key protein in response to light

...rary blindness that would otherwise be caused by a sudden increase in light intensity, such as occurs when stepping from a dark movie theater into the bright afternoon sunshine. "We knew that arrestin was transported, but we didn't know how this occurred," says Craig Montell, Ph.D., professor of biological...

Gene therapy alternative to calcium channel blockers

... can lead to more serious heart disease, stroke or sudden cardiac death. According to statistics from the Heart Rhythm Society, sudden cardiac death for which the most common cause is arrhythmia is a leading cause of death in the Uni...

University of Chicago scientists pinpoint cellular cause of SIDS

...l clue to understanding and ultimately eliminating sudden infant death syndrome, the leading cause of post-neonatal mortality in the United States. Approximately 3,000 infants die each year from the disorder, according to the Centers for Disease Control and Prevention. In the July 8, 2004, issue of the jou...

Deserts and rainforests are equally productive during drought

... seen," said Smith. "A danger is that if we have a sudden drought, according to the RUEmax data, the older global models are likely to overestimate the capacity for plant production. We can't underestimate the value for this kind of study on making real predictions." "There will be always be adaptation to ...

Clinical judgement still counts strongly alongside genetic testing

...ifying a genetic condition, whether inherited or a sudden occurrence, exonerated parents over their child's problems and alleviated their feelings of guilt and responsibility. In addition, a 'medical label' provides access to support and resources, including educational and other medical services. ...

Researchers show 'clot-busting' at stroke site is viable option

...ariables, as well. Major stroke symptoms include a sudden inability to move a leg or arm, slurred speech or being unable to talk, sudden blindness, a sudden headache or numbness throughout one side of the body. Finally, the researchers a...

JGI, VBI help unravel sudden oak death & soybean disease

...amorum, in effect serving as the Rosetta Stone for sudden oak death. "The genome sequence of P. ramorum will help researchers to track the spread of SOD much more accurately by enabling them to develop more detailed genetic fingerprints," says Tyler. "Based on experience with developing fingerpr...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument