Tag: "acting" at biology news

Increasing biodiversity is not always best

...ines, director of the Marine Science Institute and acting vice chancellor for research at UCSB; and James H. Brown, professor of biology at the University of New Mexico studied data collected on oceanic island land birds and plants. Records from islands are useful because they present discrete areas where ...

Engineers work on their SUNTANS as they track waves and beaches

...accelerations of fluid masses caused by the forces acting in the ocean," explained Street, the William Alden and Martha Campbell Professor in the School of Engineering. "They're very hard to solve, in part because things like wind on the surface or varying densities in the fluid itself can produce a complex...

The mouse genome and the measure of man

...ly funded international consortium that is already acting to stimulate biomedical research," says Jane Rogers, Ph.D., Head of Sequencing at The Wellcome Trust Sanger Institute. "Its value is predicated upon the quality of both the sequence and the tools to interpret it, all of which are freely available thr...

University of Pittsburgh findings published in Science illustrate how KSHV causes cancer

...-suppressor pathway during the immune response and acting like a switch by turning off the production of IFN. In addition, in some cells, vIL-6 not only stops the suppression of tumors, but also causes normal cells that are not infected with KSHV to proliferate abnormally. "These results illustrate that tum...

A genetic basis for aggression and anger

...ng of the neural bases of aggression. Vasopressin, acting through its 1a receptor subtype, is known to affect aggressive behaviors. The vasopressin 1b receptor (V1bR) is also expressed in the brain, but has received much less attention due to a lack of specific drugs. Here we report that mice without the V1...

Geoenvironmental Research Park is launched

...conduct a range of front line research, as well as acting as an 'incubator' for a number of high-tech companies working in the broad field of the environment and sustainability. In this way the Park will be involved in programmes of research, application, and development for problems dealing with environmen...

Research on lentiviruses to continue at Ohio State

...h as 15-fold. Glen R. Hanson, acting director of the National Institute on Drug Abuse, agreed saying, "We are pleased with the agreement between NIDA and Ohio State which will allow the continuation of this important research. ...

Transforming textbooks: AAAS and partners target K-12 science materials for improvement

...ation process, according to Dr. Jo Ellen Roseman, acting director of Project 2061. The Center will "foster essential research and development aimed at helping all students learn what they need to know to thrive in our science-based world," said Roseman. Roseman will serve as director of the Center for Cur...

November GEOLOGY and GSA TODAY media highlights

...his question: that the plates are driven by forces acting from the side, that is, pulled by subducting slabs...tion of anisotropy we find is indicative of forces acting from below being important. Thus it appears that the North American plate is driven largely by mantl...

Ancient defense mechanism may still be protecting us

...othing more than keep the cell's full genome safe, acting as a sort of "lock box." The larger nucleus (called the macronucleus), on the other hand, uses the DNA to regulate the cell's life functions. This macronucleus houses about 15 percent fewer DNA sequences than the smaller one, and when the cell mates ...

Alzheimer's, nutrition, smallpox, and other 'Human Health Frontiers' addressed by AAAS speakers

... an associate professor at Stanford University and acting Chief of Infectious Disease at the Veterans Affairs Palo Alto Health Care System. "The division shows up within the human body. We're only learning now how to identify these organisms. People can be infected and perhaps made sick by microorganisms we...

Ion channels allow bacteria to resist stomach acid

... then transported out of the cell, the whole cycle acting as a virtual proton pump that keeps the cytoplasm from becoming too acidic in the acidic environment of the stomach. However, said, Miller, these "proton pumps" -- because they move net positive charge outward -- would grind to a halt unless there we...

Dr. Francis White, FUHS/CMS, receives MERIT Award

...d how changes to the dopaminergic systems might be acting to maintain continued drug abuse in addicts, and how doctors might be able to counteract those systemic changes to curb addiction. Dr. White explained, "I'm very pleased by how clinically relevant my research has become." Dr. White also serves as a s...

Bloodworm's way with copper likely provides paradigm for new materials

...rough which venom is injected. That copper may be acting as a catalyst that activates venom being discharged by the worm into its prey. The authors include University of California Biology Professor Herbert Waite and Chemistry and Materials Professor Galen Stucky. First author Helga Lichtenegger, who was ...

NIGMS center grants will spice up chemical libraries

...ry-related methods," said Dr. Judith H. Greenberg, acting director of NIGMS. "Ready access to these new methods will give biologists, in collaboration with chemists, the ability to obtain combinatorial libraries that are tailor-made to meet their specific research needs." According to Dr. John M. Schwab, t...

Researchers discover genes that control regulatory functions in malaria mosquitoes

...ssive blood meals from humans. Regulatory peptides acting as neurochemicals and hormones govern these processes in mosquitoes, so describing and understanding these peptides are crucial steps toward control. "At this point the exact function of these genes is speculative," said Crim, a peptide-receptio...

Recreational use of the drug 'Ecstasy' causes new kind of brain damage

...erm consequences." Glen R. Hanson, Ph.D., D.D.S., acting director of the National Institute on Drug Abuse, adds, "This study underscores the need for more research about the extent and nature of the damage that Ecstasy may cause. Clearly, the implications of these findings are cause for concern and should...

Biologists new experiment may vindicate Darwin

...y inspects the number of the bristles on each fly, acting like a sort of natural selection by removing sparsely bristled flies from the bright area and more densely bristled flies from the darker one. The bristles act as a marker that Fry can track over generations. The leftover flies in each habitat are th...

Conference focuses on drug abuse effects on neuroimmunity, infectious diseases

...Dementia)." Keynote speaker Glen Hanson, PhD, DDS, acting director of NIDA, will speak at a banquet that evening. A panel of experts will discuss the issue "Do Drugs of Abuse Impact HIV Disease?" 9 to 11: 30 a.m. on Sunday, Oct. 6....

While some immune cells aim to fight cancer, others hold them in check

... - known as cytolytic T cells - are prevented from acting by a second set of immune cells called regulatory T cells, according to a new study from investigators at The Wistar Institute. The research also shows that the regulatory T cells communicate their message of restraint to the cytolytic T cells at a d...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... 19, 2013 Elsevier, a world-leading provider of ... announced today the publication of the National Osteoporosis ... management of osteoporosis in postmenopausal women and older ... Published in 2009 in Maturitas , the ... update is timely with an additional focus on ...
(Date:6/19/2013)... June 19, 2013 Ultimate Medical Academy ... an 11.5-hour broadcast on WFLA News Channel 8. Since ... more than $84 million for All Children's Hospital in ... themed "30 Years of Miracles," marked the second year ... UMA employees worked the phones during the Telethon, which ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
(Date:6/19/2013)... Recently, SoCal CEO Magazine staff was on hand ... in a series of six workshops where people with and without ... the mosaic tiles in their permanent location under the direction of ... Maxwell. , This mural project began in March of 2013 ... three years ago with the goal of promoting ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Maui'd ... is dedicated to being an effective and cost effective ... needs. They have partnered up with Tom Barefoot’s Tours ... discounts on most of Hawaii’s activities. , They have ... clients can get the lowest prices on their Hawaii ...
Breaking Medicine News(10 mins):Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 2Health News:Ultimate Medical Academy Rallies in Support of All Children's Hospital 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5Health News:Arc Creates Huge Mosaic Mural to Highlight the Need for Greater Respect of People with Disabilities 2Health News:Maui'd Forever Pleased to Offer Price Guarantee on Hawaii Activities 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao