Tag: "activity" at biology news

Brain Protein "Rescues" Neurons From Atrophy

...n forms of epilepsy, pathologically high levels of activity could lead to undersirable excess growth of the wrong kinds of comnnections, said Katz. Added Lo: "Loss of some kind of neurotrophic interaction could also be the basis of neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease an...

Dangerous Chemical Combination Presents Possible Scenario For Gulf War Illnesses

...a faulty form of BuChE, resulting in low enzymatic activity andthus a diminished ability to inactivate drugs or pesticides. This risk factor,which affects only 3 to 4 percent of the population, may boost the toxicityof these chemicals. "Individuals with genetic types of decreased plasma BuChe activityshould...

New Cancer Switch Discovered By Duke Medical Center Pharmacologists

...necessary, but not sufficient for the transforming activity of BCR-ABL." According to Pendergast, the discovery offers the possibility of cancer treatments that eliminate drug-resistance by selectively rendering tumor cells vulnerable to normal cell death when treated with anti-cancer drugs. In the paper in G...

Honeybees In The Wild Nearly Gone In North America

...so likely to lose outto a safer and more lucrative activity for beekeepers, Tew said-- honey production. "The price of honey has doubled in the last 18 months,"he said. "In many cases, honeybees will be redirected intohoney production rather than crop pollination. It's a less riskybusiness decision for the be...

Hawaiian Whales Show 'No Overt Response' To Sounds Of ATOC Simulation

...'s ambient sounds, such as wind and waves, seismic activity and animals, including the humpbacks themselves, vocalizing loudly. Offshore human activity -- from kayaks and larger recreational craft to fishing boats, tugs and barges, and U.S. Army landing ships -- produces loud sounds. "We're getting ver...

Salvage Gene Is At The Root Of Many Mutations

...ered that most mutations in yeast are causedby the activity of an enzyme that acts to salvage irreparably dama...t all mutations inDNA, ironically, result from the activity of one of the DNA repair enzymes, REV1. "We really found something that we weren't at all looki...

How Birds Sing

...otes and more complex passages of a bird's song to activity in different areas of the brain. The researchers w...inx--the bird's voicebox. They recorded electrical activity just outside individual brain cells of interest, and compared the signal with sounds the birds made....

Discovery Could Help Understand Breast-Cancer Therapies

...cription signal (the message system)for biological activity important in bone maintenance, especially for postmenopausalwomen, and for cardiovascular protection. But estrogen also increases therisk of breast cancer in some women. "We've identified portions of the hormone-binding domain of this proteinthat ap...

New Software Provides Quick Analysis of ion-Channel Activity

BUFFALO, N.Y. -- The interpretation of the activity of ion channels -- the protein structures that reg... the properties of ion channels, which control the activity of the body's organs, including the brain, is key to understanding normal physiology. It also is cr...

Newly Discovered Gene Halts Cell Division and May Have Cancer Link

... Science . The study suggests that if the gene's activity is blocked, cell division continues haphazardly and can lead to the formation of new cells that are missing chromosomes -- an event that is notoriously linked to tumor growth. The researchers suspect that certain genetically unstable breast, ovarian...

Six-Year Drilling Project to Uncover One Million Years of Earth History

...mine how the volcano was formed, types of volcanic activity that have occurred, and mantle mechanisms that pro...from the slopes of Mauna Kea, has slowed from peak activity 500,000 years ago. Mauna Kea has subsided (settled) by more than 3,400 feet during the last 400,000...

Two Long-sought Diabetes Gene Found

...ome 12 and one on chromosome 20 that regulate the activity of other genes. "Both of these are known genes but neither one was considered likely to play a role in diabetes," said Bell. Both genes turned out to be "transcription factors," proteins that control how and when other genes are turned on or off. Bot...

New Sensor Provides First Instant Test For Toxic E. coli Organism

...he rightreceptor site, they attempt to bind. This activity in humans causes disease.In the sensor, it is what triggers the color change." The backbone of the sensor molecule is composed of a long diacetylene lipid, amolecule similar to the phospholipids that are the building blocks for cellmembranes....

Disease Resistance Mechanism Identified in Plants

...ral disease is somehow linked to the complementary activity of genes in both the plant and the pathogen - the disease-causing agent. Previous genetic research has suggested that an avirulence gene in the pathogen triggers a resistance response in the infected plant. The researchers tested this conjec...

Mechanism For Disease Resistance Identified In Plants

...ral disease is somehow linked to the complementary activity of genes in both the plant and the pathogen - the disease-causing agent. Previous genetic research has suggested that an avirulence gene in the pathogen triggers a resistance response in the infected plant. The researchers tested this conjec...

Moving DNA Molecules With Magnetic Tweezers

... the DNA with fluorescentdye, he can observe their activity through a microscope. This breakthrough has allowed Wirtz to make critical measurementsof how a single DNA molecule moves and changes shape. At rest,DNA is a long, chain-like molecule that coils itself into theshape of a ball. When one end is pulled ...

Erodible plastic microspheres could be effective oral drug delivery system

...tyin the bloodstream. For example, the increase in activity of dicumarol could beexplained by intestinal uptake of up to 47 percent of the microspheres afterfeeding. Usually, when dicumarol is administered orally, very little of it isabsorbed. In the study, the dicumarol also remained in plasma for much longe...

Cell-Membrane Proteins Appear To Play Key Role In Squid's Swiftness

...ium channels open and close, the faster electrical activity is turnedon and off, and the faster impulses can b... 1970s, other researchersnoted that sodium-channel activity seemed unusually slow in some snails.In 1993, Gilly's group cloned a squid gene, suspecting it was a...

Purdue Study Aims To Boost MRI Capabilities

...r, and to view transient phenomena such as cardiac activity and blood flow in a noninvasive way," says Joe Bourland, director of bioengineering research at Purdue's Hillenbrand Biomedical Engineering Research Center. In addition, such machines could lower the cost of MRI scans, because each patient would spen...

Ozone 'Chat Room' Provides Real-Time Air-Quality Research

... on a weekly cycle, so this graphically ties human activity during the work week to ozone production," says Schichtel, who has concentrated greatly on meteorological data to develop ozone transport animations. The animations, available through the OTAG Washington University website, show pulses of ozone movi...

1 2 3 4 5 6 7 8 9 10

(Date:8/29/2014)... Pursuing its deepest desires to help build ... stunning new design that promises to redefine the global ... surrogacy platform has witnessed a 42 percent increase in ... month, the FindSurrogateMother.com community is formed by hopeful parents ... — the precious gift of life. , Whether intended ...
(Date:8/29/2014)... News) -- If you have bunions, taking care of them ... expert says. A bunion is a bump that forms ... tissue moves out of place and extends beyond the normal ... pain and may require surgery to correct, said Brent Rosenthal, ... Freehold, N.J. To prevent bunions, avoid wearing shoes with ...
(Date:8/29/2014)... NEW YORK August 29, 2014 - Despite US ... obesity, there are many barriers, several of which may ... study by researchers at NYU Langone Medical Center published ... General Internal Medicine ( JGIM ). , David ... Department of Internal Medicine at NYU Langone, and colleagues ...
(Date:8/29/2014)... AURORA, Colo. (Sept. 2, 2014) A team of ... has reported the breakthrough discovery of a process to ... patients. These findings could have implications that extend beyond ... and autoimmune diseases., In an article published ... the Charles C. Gates Center for Regenerative Medicine and ...
(Date:8/29/2014)... 29, 2014 Today, NBC’s “The ... who profiled a handful of safe, back to ... Research. This year, many schools will include earphones ... innovator of hearing wellness solutions, offers the best ... Earphones, offered in yellow, pink and black, sound ...
Breaking Medicine News(10 mins):Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 2Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 3Health News:Take Steps to Control Bunions 2Health News:Options for weight loss your primary care doctor might not know about 2Health News:CU scientists' discovery could lead to new cancer treatment 2Health News:The Today Show Features ETY•Kids® Safe-Listening Earphones by Etymotic 2
Other Tags
hayfevershotantelopesaigakineticsilymarinplasticityinvasionsendocrineaaccmightdiscovereddefectataxiafriedreichreverses