Tag: "adapted" at biology news

Purdue Finding May Snuff Out The Sniffles

... receptor," Rossmann says. "The virus probably has adapted itself to be able to attach to this particular molecule in humans, so that they fit exactly, similar to a lock and key." As the virus attaches to one or more receptor sites on a cell, the cell membrane engulfs the virus, wrapping around it and allowi...

Poison-Eating Bugs Strike Gold

...s, this system uses uniquely Australian organisms adapted to the local conditions. "We found these bacteria thriving in the tailings ponds of a gold mine in the Western Australian goldfields," Dr Franzmann explains. Part of the project is to develop a modified bioreactor to process the mine effluent...

Eating Less Fat At One Meal May Lead To Higher Fat Intake Later

... over the firstfew days of the study, the students adapted by day four and there was nooverall difference in calorie intake among the groups. Also, the subjectswere asked to keep a log of how hungry they felt just before drinking theirlunchtime shake and in the five hours afterwards. The groups’ answe...

Very Fruitful Collaboration Between French And German Scientists Yields Unusual Insights Into The Structure Of Membrane Proteins

...y and those of function, and has specific dynamics adapted to different conditions of solvent environment, temperature or pressure? Evidence is accumulating for the lateral organization of cell membrane lipids and transmembrane proteins in the context of sorting or in...

Duke Studies Show That Environmental Effects Of Dams Extend To Insect Life

...erfly species that dine only on rotting fruit have adapted tothe flooding, completed in 1986. Using a small motorboat, she and her assistantsvisited four tiny islands weekly to make butterfly inventories. The now-isolatedislands were located between 0.1 and 3 kilometers (a kilometer is about 6/10thof a mile)...

Scientists Discover How Influenza Virus Becomes More Deadly

...d from the strain that caused the 1918pandemic and adapted to grow in mice. Through their experiments, they foundthat its NA molecule has two distinct structural features that enable it to bindand trap plasminogen, a precursor to plasmin, and thereby accelerate HA cleavageand promote widespread infection of...

Evidence For Earliest Maritime-Based Societies In The Americas Reported In Science Magazine

...le in South America (or elsewhere in the Americas) adapted toliving along the shore. The findings from the two sites, named Quebrada Jaguayand Quebrada Tacahuay, suggest that the people who dwelled there "possessed afairly sophisticated knowledge of exploiting coastal areas," says DanielSandweiss of the Univ...

The Evolution Of Beauty, Part Of A Special Section On The Evolution Of Sex In The 25 September 1998 Science

...n furtheralong the family tree are moths that have adapted this sensory channel forcommunication between the sexes, males and females who woo each other inultrasonic displays of affection. To Ryan and others, the theory's main strength is its simple logic. "Any sensorysystem is going to be more responsive to...

University Of California-San Francisco Researchers Report Test That Detects Prion Diseases, Illuminates Novel Findings About Infectious Prions

...he researchers said they believe the design can be adapted for large-scalerobotic processing. By contrast, current detection models, called bioassays, involve insertingsuspected infectious tissue into the brains of laboratory animals and observingthem for development of the disease. The process takes betw...

American Society Of Animal Science Recognizes Global Scope Of Virginia Tech Researcher's Work

...ents," Notter said. "Thebreeds that are there have adapted to the local conditions. If we just bring inbreeds from alien environments, we stand the chance of losing genetic resourcesthat have developed over many generations. We also stand the chance of thatintroduced breed failing in an environment to which ...

Aluminium Study Puts Drinking Water In The Clear

...suring trace minerals in environmental samples,was adapted to measure the amount of aluminium in blood and urine. The newtechnique was able to accurately detect lower levels than could ever be measuredbefore. "Using this technique we were able to draw a more complete picture of how thehuman body copes with ...

Quicker Implementation Of Research Results

...accomplished that requireengineering systems to be adapted to changing environmental conditions. Areas ofapplication of the novel components explored at the centre of excellencefocusing on "Adaptive mechanical systems - ADAMES" at the University ofMagdeburg include controlling the wing shape of high-speed ai...

History Of The Rainforest Told In Song

...rs. The upland birds that Dr. Westcott studies are adapted to the cool, moist foresttypes that today grow on the mountain tops - but which a few thousand years agowere probably far more widely distributed. With the gradual warming in theearth's climate since the ice sheets retreated, these areas have contra...

Garlic Perfumes Poultry Houses

...r content of the eggs." While the chickens adapted to eating garlic right away, hogs in acompanion test were more reluctant to accept the new feed. "Hogs have a very sensitive sense of smell. That's why they're usedin France to find truffles," Birrenkott said. After a day or so ofboycotting t...

Greater Prairie Chicken Appears On Comeback Trail In Illinois

...dbrought in prairie chickens from Texas, which had adapted to the hot climatethere, we may not have had the same success." The success - in which more than 500 birds were brought in beginning in 1992from larger populations in Minnesota, Kansas and Nebraska - could serve as amodel to save dwindling population...

Evidence Appears Strong To Bolster Concept Of Co-Evolution, Scientists Say

...Minnesota and in northern and central Illinoishave adapted to each other, thescientists report. Webworms feed on the reproductive structures of parsnips, soresistance to the insect is vital to parsnipsurvival. At each site, levels in the plants of four defensive compounds, calledfuranocoumarins, match remark...

American Heart Association Announces Top 10 Research Advances For 1998 -- Gene Therapy Among The List

...r preliminary findings suggest that the MRI can be adapted to freeze-frame the beating heart so that "unstable" plaque in the coronary arteries also can be detected. If this imaging technology proves effective in identifying unstable plaque obstructions in the blood vessels, it will provide a way for cardiol...

Gap Widening Between Genetic And Behavioral Research

...prehensive understanding." The article was adapted from Anderson's address to the 37th annualmeeting of the Society for Psychophysiological Research in October 1997....

Swimming Proficiency Of Marine Mammals Ranks Them Among The World's Elite Animal Athletes

...types ofanimals, modern marine mammals are so well adapted to aquatic life that they areas efficient in swimm... Williams said. "The trick is the chassis has tobe adapted to the environment, and that means specializing." Semiaquatic animals that try to have it both wa...

New Model For Assessing The State Of The Environment

...emical and biological aspects. The models havebeen adapted for current regional and nation-wide environmental monitoring schemes and environmental goals. An assessment of the forest landscape, for example, includes criteria for the proportion of ancient forest, deciduous forest and dead wood, as well as the ...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan