Tag: "advanced" at biology news

Tumor Suppressor Gene Located In Liver Cancer Cells

..., the researchers said. The disease is often far advanced at detection, and the five-year survival rate in the United States is only 4 percent. A report on this tumor suppressor gene appears in the December issue of Nature Genetics. Along with principal investigator Randy Jirtle, Gerald R. Hankins and Mary...

Dating A Caveman

...to 400,000 years old. Previous studies, using less advanced methods, dated the remains in the 200,000- to 300,000-year-old range. Ku - a professor in the Department of Earth Sciences who was recently elected to fellowship in the American Geophysical Union for his pioneering work in the field of geochronolog...

Children Become Gorillas In VR Zoo

...ul educational tool," she said."The partnership of advanced technological capabilities and accuratebehavioral information from zoo researchers can allow children to trulyexperience the dynamic social world of these fascinating creatures." The project also "has implications for learning about peacefulresoluti...

Transgenic Rice Plants Resist Insects, Drought And Salt Damage

...t. Transgenic plants from both technologies are in advanced stages of testing, with large field tests scheduled this year in China. Commercial production of seed is about two years away, Wu estimated, but several companies have already signed licensing agreements to use the insect-resistance gene technology ...

Genetic Alterations Linked To Cancer In Some Blood Samples

... in the blood appears to be associated with large, advanced tumors and with cancer that has spread," says lead author David Sidransky, M.D., associate professor of otolaryngology/head and neck surgery, and oncology. Sidransky cautions that the test does not appear useful as a screening test for cancer. "But...

Low-Protein Diet May Reverse Kidney Disease

...two years. The other 11 participants, who had more advanced kidney failure before starting the study, showed temporary improvement, but all eventually went on dialysis. Nephrotic syndrome usually is treated with drugs and only modest reduction of dietary protein to reduce the loss of protein in the urine. Sev...

Emory Researchers Advance Gene Therapy Studies For Metastatic Melanoma Treatment

...hers believe it might be used to effectively treat advanced cases of melanoma. In gene studies on melanoma t...a new protocol using GM-CSF to treat patients with advanced melanoma in the very near future. "The most effective strategies for treating melanoma may well tu...

Evolution Re-Sculpted Animal Limbs By Genetic Switches Once Thought Too Drastic For Survival

...s are long and feathery for swimming." But in more advanced crustaceans, the first segment in which Ubx-abdA is turnedon lies farther back along the body. In these animals, the first few thoracicsegments have appendages that look like those of the head. These maxillipeds arenot just misplaced jaw parts but ha...

MGH-Led Team Finds Gene For Crippling Neurologic Disorder

...patients are fatigued or stressed. Patients with advanced dystonia may be confined to a wheel-chair or bedridden. The lifelong condition is more prevalent than Huntington's disease or amyotrophic lateral sclerosis (ALS or Lou Gehrig's disease) among the general population and has a higher frequency among A...

Computer Model Offers New Insight On Bacterial Photosynthesis

CHAMPAIGN, Ill. -- Using advanced computer modeling, scientists workingwith photosyn...he entire photosynthetic unit, Hu and Schultenused advanced computer simulation to combine their LH1 and LH2 models withthe already known structure of the react...

Disease Takes Its Toll On Waterfowl Populations

...s of the legs and wings and labored breathing. In advanced stages of the disease, the birds cannot hold their heads up, and often drown or suffocate. Most outbreaks of type C botulism occur in ducks, and species such as pintails, shovelers, and mallards are among those that suffer the greatest losses. How...

Dendritic Cell Therapy For The Treatment Of Cancer

...blem that Dr Austyn foresees is that patients with advanced cancer oftenhave weakened immune systems. Therefore it is possible that even the mostpotent dendritic cells will not be able to switch on a strong enough immuneresponse to totally eradicate cancers. However, Dr Austyn suggests that thisproblem may ...

Increased Amount Of Enzyme In Brain May Be Marker Of Alzheimer's Disease

... probably is inserted into the amyloidplaque at an advanced stage of maturation, at a time when the plaque is becomingassociated with pathogenic properties," Mesulam said. Other investigators on this study were Angela L. Guillozet and John F.Smiley, research assistant professor of neurology, Northwes...

Vertex Pharmaceuticals Researchers Report Three-Dimensional Structure Of Hepatitis C Helicase Enzyme; Report In Structure

...sign,an approach to drug discovery that integrates advanced biology, biophysics andchemistry. The Company is concentrating on the discovery and development ofdrugs for the treatment of viral diseases, multidrug resistance in cancer,autoimmune diseases, inflammatory diseases, and neurodegenerative diseases....

UPCI Researchers Find Drug Improves Cancer-Fighting Ability Of Vitamin D

...ucted preliminary trials of this agent in men with advanced prostate and other cancers. However, the use of 1...ical protocol combining a steroid with 1,25-D3 for advanced cancer. Dexamethasone appears to enhance 1,25-D3 activity by 'telling' tumorcells to increas...

Experimental Trial Combines DNA Vaccine With Triple-Drug Therapy To Stop HIV

... genes --env, rev, gag, and pol -- and is the most advanced version of a new DNAimmunization technology that has demonstrated the ability to spark a range ofimmune system responses in previous animal and human trials. In a trialconducted last year with HIV-positive patients, for example, a vaccinecontaining o...

Memorial Sloan-Kettering Investigators

...ch as controlling cell growth and maturation.Using advanced analytical techniques, Dr. Pandolfi's group showed that unlikeRAR , proteins produced by the PML-RAR and PLZF-RAR gene fusions turned off,or "repressed," the expression of the cell's genes that normally prompt a cellto mature into a healthy, funct...

Pacific Northwest Staff Win National Awards For Transferring Research To Industry

... the awards for transferring andcommercializing an advanced soil remediation technology and two innovative software products. Theresa Bergsman, Janet Roberts, Rick Brouns and Doug McKinley transferred theSix-Phase Soil Heating technology that was developed for the Department of Energy as a faster,cheaper way ...

American Museum Of Natural History Researchers Announce Discovery Of Oldest Known Fossil Ants - 92-Million-Year-Old Fossils Found In New Jersey Amber

...l stings.)The discovery of both primitive and more advanced fossil ants in92-million-year-old amber shows that the major lineages of ants arosebefore the great extinction at the end of the Cretaceous, 65 million yearsago. A reasonable estimate would place the origin of ants in the LowerCretaceous at about 13...

Ant Pheromone May Aid Alzheimer's Patients

...s. Butarmy ants, generally regarded as being more advanced in an evolutionary sense,can summon thousands of compatriots with a single chemical signal. And moreprimitive ants, lacking a recruitment pheromone, leave no detectable trail. Setting off on a mission, a primitive ant practices tandem running -- tha...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade