Tag: "aggressive" at biology news

Despite confinement, crop genes can spread fast to wild

..., and possibly turning these wild populations into aggressive weeds. The goal, then, is to develop strategies to prevent transgene escape. "Environmentalists say we should stop planting transgenic crops, but that's not going to happen," says the Wisconsin researcher. "Aside from not growing transgenic crops ne...

Tips from the Journals of the American Society for Microbiology

...initially trying to pinpoint genes responsible for aggressive behavior in worker honeybees, the researchers stum...be found in the brains of honeybees that displayed aggressive behavior toward a hornet decoy. They believe that the RNA is an indicator of a viral infection. ...

JCI table of contents, February 2, 2004

...ly inhibiting cells that would normally mediate an aggressive immune response. The results reported by Peakman and colleagues suggest that in patients with T1DM, there is instead induction of a predominant number of T cells that produce IFN-gamma and IL-2, which drives an autoaggressive immune response. Why the...

NAFTA arbitrators in environmental case agree to formal public input, a first for trade hearings

...in future arbitrations, and would easily limit the aggressive strategic corporate use of suits of this kind. Two types of issues have concerned IISD, and motivated the initial August 2000 submission to the Tribunal to seek amicus status: The secrecy of the arbitration process, which had never been open to ...

JCI Table of Contents, January 15 2004

...h self- and foreign antigens by the suppression of aggressive T cell immune responses. As a result, they are critical in suppressing graft rejection. However it is not known whether this response is mediated by T cells that have been previously exposed to antigens (memory T cells) or by nave T cells. In the Jan...

Predicting progression of common cancers

...notype is a general risk factor for metastasis and aggressive behavior in many of the most common cancers. And the serum-response expression signature provides a valuable new diagnostic tool for predicting tumor behavior and determining a patient's prognosis....

Wound-healing genes influence cancer progression, say Stanford researchers

...active wound-healing genes turned out to be highly aggressive and were more likely to spread to other tissues. Chang said assessing wound-healing genes could help doctors choose the best treatment for a patient. "There are a lot of drugs that work only on certain type of cancers. If you realize that different...

California pistachio industry threatened by potentially devastating disease

...a dothidea, a fungus that causes diseases that are aggressive and very difficult to control. According to Michailides, the pistachio industry in California is based on a cultivar that is very susceptible to this particular fungus. "Because of the California pistachio's susceptibility to this fungus, panicle and...

World's leading 'mad cow' diagnostic company, responds to USDAs additional BSE protection measures

...y the USDA and its decision to bolster the already aggressive surveillance, detection and response program," said Dr. Bruno Oesch, president and CEO of Prionics. "The USDA's additional actions will further strengthen U.S. prevention systems and the confidence of both consumers and customers around the world." ...

Alcoholics with antisocial personality disorder have blunted emotional reactivity

...ildren and adolescents with CD, such as persistent aggressive and impulsive behavior and failure to adhere to societal norms, may be a marker for underlying deficits in emotional reactivity and related impairment in frontal-limbic processes." Although a number of studies have identified a strong relationship b...

First animal model for pancreatic cancer may lead to early detection of disease

...al therapeutic strategies. Pancreatic cancer is an aggressive and highly lethal cancer, with a lessthan 5% chance of surviving just five years past diagnosis. The diseasebegins to spread almost immediately, making treatment nearly impossible.Understanding the pathology of how pancreatic cancer develops is essen...

Novel therapies show promise against myeloid leukemia

...rectly into the tumor in vivo. In a model of very aggressive chronic myeloid leukemia in blast crisis, MSC-produced interferon alpha (IFNaMSC) inhibited tumor growth in vivo and doubled the survival rates of CML bearing mice. "These findings indicate that mesenchymal stem cells can deliver inter...

Social behavior among monkeys may be more nature than nurture

...ther than their own are more likely to exhibit the aggressive or friendly behavior of their birth mothers rather than the behavior of their foster mothers, a University of Chicago researcher has shown for the first time. The discovery of inheritability of social behavior traits among non-human primates has imp...

Communication is key to successful U.S. SARS quarantine

...an 25 countries. "It could have been worse without aggressive public health measures." SARS was a new virus that struck unexpectedly and the countries affected had little time to plan a response, Rothstein said. To combat the epidemic, the countries studied in the report imposed large-scale quarantines and the ...

Steroid use causes long-term agression, NU report indicates

...tes who abuse steroids may also be inclined toward aggressive behavior long after their drug abuse and musculature have waned....

New drug target and biomarker for advanced childhood cancer discovered

...er, could provide clues to differentiating between aggressive tumors and those that are more likely to respond to treatment, said Baylor College of Medicine researchers who discovered it. The gene that codes for the protein, called neuroblastoma-derived secreted protein or NDSP, is most active in severe cases ...

Proteins may help identify patients who will respond better to treatments in certain cancers

...y vicious, with a median survival of one year with aggressive therapy. Currently, diagnostic techniques do not distinguishbetween more aggressive and less aggressive tumors, which appear identical under the microscope....

Gliomas' 'molecular fingerprint' predicts how aggressive tumor will be

...to aggressively treat those cancers that are truly aggressive and in those that are not, avoid such powerful treatment and exposing patients to more risk than necessary." Caprioli and his colleagues have done similar work in lung cancer. Earlier this year, they reported identification of a specific pattern of 1...

Genes control severity of heart failure, study finds

...ans to identify those patients in need of the most aggressive therapies and provide new targets for drug development, Rockman said. He and geneticist Douglas Marchuk, Ph.D., also of Duke, reported their findings in the Dec. 1, 2003, issue of Human Molecular Genetics. The work was supported by the National Insti...

Asbestos cancer breakthrough

...lopment of a blood test for mesothelioma, a highly aggressive lung cancer caused by asbestos exposure. A PNRI team led by Dr. Ingegerd Hellstrom, and an Australian team, led by Dr. Bruce Robinson, of the University of Western Australia, conducted the research, which appears in the November 15th issue of Lancet....

1 2 3 4 5 6 7 8 9 10

(Date:10/25/2014)... -- Researchers who discovered antibiotics in farmed and ... concern. The use of antibiotics in animals, ... contribute to the development of antibiotic-resistant bacteria that ... the study. Each year in the United ... and kill about 23,000, according to the Infectious ...
(Date:10/22/2014)... 2014 At a time when the ... and athletes at all levels, the UPMC Sports ... current discussion where two powerful messages are lost: Concussions ... result in full recoveries every day. , In striving ... fact and research, UPMC and the Concussion Program are ...
(Date:10/22/2014)... 22, 2014 For Dr. Iris Hunter, a ... it’s an extension of her life’s mission. Her extensive experience ... the owner of FirstLight HomeCare, make it clear that Hunter’s ... me that my work makes a difference in the lives ... spirit, so after much research, I felt ready to start ...
(Date:10/22/2014)... October 22, 2014 Hay House is pleased ... Addiction and Upgrade Your Life (Paperback; $10.82) written by the ... & Recovery. This book is meant to help readers ... life of recovery. , Recovery 2.0 is not the ... Recovery 2.0 is a guide for what comes next. ...
(Date:10/22/2014)... Losing Weight Your Body’s Way , In ... in the face, it certainly can be difficult to choose ... an extra favor by doing it the healthy way? Set ... listen to your body, exercise regularly, and choose foods with ... losing weight; you need to exercise more and eat less. ...
Breaking Medicine News(10 mins):Health News:Researchers Say Antibiotics in Fish a Health Concern 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 3Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 4Health News:Dr. Iris Hunter to Host Grand Opening of FirstLight HomeCare Tomorrow 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 3Health News:ReductionGuruMD Presents Ways to Improve Your Weight Loss Results 2
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions