Tag: "aging" at biology news

Loss of circadian genes results in epilepsy

...tion factor protein family, results in accelerated aging and severe epilepsy in mice. Owing to the roughly ...hibler's group is already at work on the premature aging phenotype displayed by the triple knockout mice. "We already have some ideas on what these circadian...

Researchers establish first molecular link between eating and aging

... people," said Guarente, who has been studying the aging process in yeast, roundworms and mice for more than a decade. In the June 2 online issue of the journal Nature , scientists in Guarente's lab, including Frdric Picard, a research scientist in the Department of Biology who is lead author of the pape...

Biology of aging

...We now know that insulin is a direct player in the aging process," Tatar says. "So the research fits some key puzzle pieces together. And it should change the way we think about aging." Tatar's research is part of a growing body of evidence linking low insulin levels to increased longevity. In recent years...

The silence of the genes

... opportunity to turn on the genes shut down by the aging process. And the search for the right drugs to undo the epigenetic damage is equally wide-ranging. Jones is involved in research into the utility of a compound called azadeoxycytidine--a more specific version of azacitidine that only affects DNA and ...

Cancer drug resistance research leads to possible therapeutic target for Alzheimer's disease

...rs of protein and fat. A new model of human brain aging (Neurobiology of Aging, January 2003) postulates that mid-life breakdown of myelin could be a possible key to the later development of Alzheimer's disease. "Imaging studies and examination of brain tissue have shown that the deterioration of myelin t...

Cell division can be halted in multiple ways, with implications for cancer

...for cancerous ones cannot reproduce forever. When aging cells stop dividing, they become "senescent." Scientists believe one factor that causes senescence is the length of a cell's telomeres, or protective caps on the end of chromosomes. Every time chromosomes reproduce, telomeres get shorter. As telomere...

New insights on sirtuins, involved in gene expression and aging

...atically, hinting at a link between metabolism and aging through sirtuins. Sirtuins also promote genomic stability, a process that goes awry in cancer and particularly as one ages. Now, scientists at The Wistar Institute report new findings that further elucidate how sirtuins work and suggest how scientis...

Brace therapy for osteoarthrisis, legal issues in TBI research, prosthetic fitting

...osture control may reduce fall-related injuries in aging adults and people with balance disorders. Researchers collected balance data on healthy adults, ages 2970, to test the computational method for generating center of mass with ankle stiffness. The new computational method corrects shortcomings in an e...

Gene defect linked to premature aging

...his mutated PASG protein showed signs of premature aging and profound growth problems, including low birth-...is, which cuts the DNA into a million pieces, this aging process, called replicative senescence, lets the cell live for a limited period of time with a reduc...

Something old, something new

The relationship between genome integrity and aging is the subject of a new report in the upcoming iss... level of global genomic methylation and premature aging in mice. "In order to elucidate the function of PASG, we generated a "knockout" mouse carrying a hy...

Dietary supplement shows promise for improving immune function in the elderly

... segments of the immune system are affected by the aging process, investigators have most consistently identified abnormalities in the cellular or T-cell mediated immune function in the elderly. The decline in T-cell immune function is generally associated with an increased susceptibility to infections. Fo...

Study is another step in determining if curry can protect against Alzheimer's

...se One of the most prominent current theories of aging is the "free radical theory." According to this th...ajor cause of the degenerative diseases related to aging such as cancer and Alzheimer's disease. Luckily, mammalian cells have developed highly protective s...

World's oldest mouse celebrates milestone birthday

...e genetics and cell biology of aging. To study the aging process, he has developed strains of mice, derived...ut how genes and hormones affect the rate of human aging and risks of disease late in life. His current work focuses on identifying defects in T cells from a...

AChemS: Cutting edge research in taste, smell, & chemical irritation

... resulting from head trauma, sinus disease, normal aging and neurological disorders, such as brain injury, stroke and Alzheimer's disease. By providing a better understanding of the function of chemo-sensory systems, scientific and biomedical research is leading to improvements in the diagnoses and treatme...

UIC researchers discover gene that causes liver cancer in animals

...I know it's speculative," Costa said, "but perhaps aging is just an unintended by-product of an adaptive me...ism to stave off cancer and certain death. Perhaps aging is just nature's way of attacking cancer."...

Dirt aged hurriedly, elegantly observed

... National Laboratory that can speed soil's natural aging process to sponge up and trap organic contaminants...ids and gases. "We believe the supercritical-fluid aging process can simulate decades of contaminant exposure in just a few hours," said Christopher J. Thomp...

Evolution's twist

...es the risk of Alzheimer's and vascular disease in aging human adults. Chimpanzees who eat more meat than ...tes, but gained a higher tolerance to meat, slower aging and longer lifespan. Still, if humans developed genes to compensate for a meat-rich diet, why do so ...

JCI table of contents, 15 March 2004

... called adipocytes. An intriguing fact is that in aging individuals while osteoblast development declines, there is an increase in the presence of adipocytes in the bone marrow. In the March 15 issue of the Journal of Clinical Investigation, Hiroshi Kawaguchi and colleagues, from the University of Tokyo...

The bare bones of cutting the fat

... called adipocytes. An intriguing fact is that in aging individuals while osteoblast development declines, there is an increase in the presence of adipocytes in the bone marrow. In the March 15 issue of the Journal of Clinical Investigation, Hiroshi Kawaguchi and colleagues, from the University of Toky...

MGH study finds female mammals produce egg cells into adulthood

...findings hold up in humans, all theories about the aging of the female reproductive system will have to be ...r. But the problems could instead be the result of aging of the germline stem cells that produce the oocytes. If these stem cells could be identified and iso...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument