Tag: "already" at biology news

Potential for enhanced sequestration of carbon in soils supports evaluations

...pture to reduce emissions or remove carbon dioxide already in the atmosphere. Post and his colleagues considered the range of possible costs and benefits that could accrue from adopting land-management practices designed to increase the uptake of carbon dioxide by soils. The increasing concentration of carbo...

Landmark gene agreement announced by Samoan government and UC Berkeley for anti-AIDS drug Prostratin

... genetic engineering, the bacterial factories have already proven useful in producing precursors of the anti-malarial drug artemisinin, which he hopes to produce inexpensively for people in the developing world. The process also can be used to produce flavors and fragrances, many of which also are isoprenoid...

Landmark agreement between Samoa and UC Berkeley could help search for AIDS cure

... genetic engineering, the bacterial factories have already proven useful in producing precursors of the anti-malarial drug artemisinin, which he hopes to produce inexpensively for people in the developing world. The process also can be used to produce flavors and fragrances, many of which also are members of...

Lycopene slows human prostate tumour growth in mice and combined with vitamin E is even better

...tamin E. A number of epidemiological studies have already indicated that high intake of lycopene a carotinoid that gives the red colour to tomatoes and other fruits is associated with a reduced risk of prostate cancer. But, these observational findings have now been underpinned by new research demonstrati...

Scientists to prototype cyberinfrastructure for research and education access to ocean observatories

...ore Southern California. "A number of projects are already underway to deploy ocean observatories and sensors...he northern loop of the network, with C$62 million already committed from NEPTUNE Canada in partnership with ORION, is scheduled to be operational in 2007, wit...

AAAS US Presidential Candidates' Forum

...cientific evidence is clear that global warming is already happening and rising levels of global warming pollution are making the problem worse." He proposed that the solution lies in negotiating with and working with other nations. Although Bush's article in Science noted "key uncertainties remain concernin...

New study indicates arsenic could be suitable as first-line treatment in type of leukaemia

...as a treatment for a rare type of leukaemia. It is already licensed as an orphan drug (the term for drugs intended to treat rare conditions) for patients who have relapsed after initial therapy for acute promyeloctytic leukaemia (APL). But now, a research team led by Dr. Ardeshir Ghavamzadeh and Dr. Kamran A...

Microscopic miracles

...nce (September 27-29). The first nanomedicines are already bringing clinical benefit to thousands of patients...been remarkable. A growing number of products have already secured regulatory authority approval and, in turn, are supported by a healthy clinical development ...

UCSF scientist Joe Derisi named MaCarthur Fellow

...), headquartered at UCSF's Mission Bay Campus, has already made significant strides against the malaria parasite, Plasmodium falciparum, which infects 200 to 300 million people world wide each year, mostly in tropical climates, such as sub Saharan Africa, and kills 700,000 to 2.7 million people annually, mos...

A test case for DNA barcodes to identify species

...species' identified from the barcode against those already established by taxonomic methods. They found that all 260 bird species had unique genetic barcodes. In the 130 species represented by two or more individuals, gene sequences were either identical or closest to other sequences within that species. The...

DNA barcode finds four new bird species

...h as morphology and behavior, some taxonomists had already suspected that these species should be split. The DNA barcode data confirmed the suspicions. In the future many more species will be discovered both by splitting currently described species and by identifying the millions of unknown organi...

Rice finds 'on-off switch' for buckyball toxicity

...yballs should be studied in more detail, and we're already working to arrange additional studies."...

Operation Dangling Dino

...t the museum for the public to enjoy (the skull is already on display at the Utah Museum of Natural History). WHERE: Northeast of Henrieville, Utah, near Highway 12 in The Blues area, south of Powell Point. WHEN: The airlift will take place on Sept. 29 at 8 a.m. MDT. The early time schedule will a...

Master of antimalarial resistance

A malaria parasite gene called pfcrt, already confirmed as the culprit behind resistance to the drug chloroquine in the malaria species Plasmodium falciparum, may be responsible for resistance to several other antimalarial drugs as well, a team of researchers reports in the 24 September issue of...

Flexible pain relief with morphine-free poppy

...r of Agricultural Research, Dr Tony Fist. Tasmania already grows over 40 per cent of the world's legal poppy crops and Norman will ensure Tasmania stays an international leader in pharmaceutical development from poppy compounds. This research is supported by voluntary contributions from industry with match...

Enzyme maintaining chromosome ends is linked to bone cancer recurrence, decreased survival

...rate of PFS among 31 patients whose cancer had not already spread by the time they were found to have with osteosarcoma. Among those whose tumor cells contained TERT, the rate of PFS was 33 percent; while among those whose tumor cells lacked TERT, the rate of PFS was 72 percent. Finally, among 31 children fr...

New fossil sheds light on old mystery

... was able to see Dinocephalosaurus' body, it would already have been lunch," Dr. LaBarbera said. "Dinocephalosaurus sheds new light on the evolution of protorosaurs and the functional morphology of these long-necked marine reptiles," said Chun Li, lead author and assistant research fellow at the Institute of...

University of Alberta researcher looks for clues to mysterious disease

...where Campbell hopes to apply her work. Scientists already know that the A-T protein (ATM) is fundamental to repairing DNA damage so she and her research team are studying ATM mutants, which behave as cells do when they are damaged. In a recent issue of the journal, "Current Biology," Campbell describes...

Cannabis may help combat cancer-causing herpes viruses

...n good" to patients whose immune systems are often already weakened....

Grant advances biochemical engineering laboratory

...economic development in South Dakota. In fact, it already has, through ethanol plants that have popped up in eastern South Dakota. Several chemical engineering graduates from Tech work in these plants, bringing valued-added benefits to the farmers of South Dakota. "South Dakota is an agricultural state," Gi...

1 2 3 4 5 6 7 8 9 10

(Date:10/25/2014)... -- Researchers who discovered antibiotics in farmed and ... concern. The use of antibiotics in animals, ... contribute to the development of antibiotic-resistant bacteria that ... the study. Each year in the United ... and kill about 23,000, according to the Infectious ...
(Date:10/22/2014)... 2014 At a time when the ... and athletes at all levels, the UPMC Sports ... current discussion where two powerful messages are lost: Concussions ... result in full recoveries every day. , In striving ... fact and research, UPMC and the Concussion Program are ...
(Date:10/22/2014)... 22, 2014 For Dr. Iris Hunter, a ... it’s an extension of her life’s mission. Her extensive experience ... the owner of FirstLight HomeCare, make it clear that Hunter’s ... me that my work makes a difference in the lives ... spirit, so after much research, I felt ready to start ...
(Date:10/22/2014)... October 22, 2014 Hay House is pleased ... Addiction and Upgrade Your Life (Paperback; $10.82) written by the ... & Recovery. This book is meant to help readers ... life of recovery. , Recovery 2.0 is not the ... Recovery 2.0 is a guide for what comes next. ...
(Date:10/22/2014)... Losing Weight Your Body’s Way , In ... in the face, it certainly can be difficult to choose ... an extra favor by doing it the healthy way? Set ... listen to your body, exercise regularly, and choose foods with ... losing weight; you need to exercise more and eat less. ...
Breaking Medicine News(10 mins):Health News:Researchers Say Antibiotics in Fish a Health Concern 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 3Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 4Health News:Dr. Iris Hunter to Host Grand Opening of FirstLight HomeCare Tomorrow 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 3Health News:ReductionGuruMD Presents Ways to Improve Your Weight Loss Results 2
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions