Tag: "amazing" at biology news

Plant respiration not just an evolutionary leftover, study shows

...scientists have come to understand that plants are amazing biochemical factories that harness energy from sunlight to convert water and carbon dioxide into sugars that fuel the plant, while giving off oxygen. Though elegantly simple in concept, this process, known as photosynthesis, is remarkably complex in ...

Save the rainforest - eat a tree

...sity of Utah, says the research sheds light on the amazing diversity of species in tropical rainforests. "Understanding diversity is a holy grail in ecology," Coley said. "Part of diversity is how many species you can pack into a given habitat, but part is how many different habitats exist that can ...

UCSB professor and director receives two national awards

...he very best peer-reviewed journals. These show an amazing diversity of interests and accomplishments. Jim is a great collaborator, as shown by the number and exceptional breadth of his co-authored publications. He has also trained as graduate students some outstanding mammalogists ." Reichman was also ...

New model can aid in understanding immune system diseases

...at the appropriate time. "The viral protein is an amazing mimic of the normal protein but, in a way, the viral protein does its functions too well," Bishop said. "The viral protein causes abnormal survival and activation of these B cells." Lymph nodes all over the bodies of these mice are enlarged by exces...

Far more men than women favor routine paternity testing at birth

... of men favoring such testing wasn't higher. "The amazing thing is that the guys are always split 50-50. Age and income groups don't seem to matter," said Lisa Hayward, a UW doctoral student in biology and lead author of a paper reporting the findings in the current issue of the journal Evolution and Human ...

Cancer vaccine based on pathogenic listeria bacteria shows promise targeting metastases

...to the cell's machinery, the bacteria spread in an amazing fashion. They generate comet-like tails that push them around the cell like a speedboat. Eventually, they slam into the cell membrane and pop from one cell into the next, spreading the infection. Six years ago, Matthew D. Welch, an associate profess...

Scientists sequence genome of kind of organism central to biosphere's carbon cycle

...ybrid genome. "This project helps illustrate the amazing diversity of life on our planet," Armbrust says. "Diatoms display features traditionally thought to be restricted to animals and other features thought to be restricted to plants. Diatoms, with complete disregard for these presumed boundaries, have m...

1 2 3 4 5 6 7 8

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument