Tag: "antitumor" at biology news

Study of possible anticancer drug reveals new mechanism of gene regulation

...sights into the molecular mechanism of rapamycin's antitumor activity and may provide new targets for drug development." As an immunosuppressant, rapamycin is different from other drugs. While other immunosuppressants tend to promote the growth of cancer cells, rapamycin blocks the proliferation of tumors. In ...

Drug averts Parkinson's disease in fruit flies, suggesting new approach for humans

...ich are now undergoing clinical trials as possible antitumor agents. However, she says these findings should stimulate chemists and pharmaceutical researchers on the trail of a new class of drugs that, by bolstering molecular chaperones, could prevent neurodegenerative disease from ever taking hold "These st...

UW scientists find genetic pathway to potent anticancer agents

... times more potent than some of the most effective antitumor agents now in use -- it takes very little to kill ...iting factor on the availability of enediyne-based antitumor drugs. With a map of the genetic pathway that governs the enediyne microbes' ability to produce the...

Making the most of lymphopenia

...T cell homeostatic proliferation elicits effective antitumor autoimmunity" is authored by Wolfgang Dummer, Andreas G. Niethammer, Roberto Baccala, Brian R. Lawson, Ralph A Reisfeld, and Argyrios N. Theofilopoulos and appears in the July 15, 2002 issue of The Journal of Clinical Investigation....

Cell Genesys reports long term survival data in Phase II trial of GVAX prostate cancer vaccine

... vaccines. GVAX cancer vaccines have demonstrated antitumor effects against every type of human cancer against which they have been tested to date and are currently being evaluated in five types of cancerlung, prostate, pancreatic, leukemia and myeloma. Currently, Cell Genesys is evaluating non patient-speci...

Other highlights in the May 15 issue of JNCI

...12) protein therapy has been shown to stimulate an antitumor response; however attempts to deliver the gene int...ell as triggered an immune response. Moreover, the antitumor memory lasted more than 11 months. The authors conclude that IL-12 electro-gene therapy could potent...

Other highlights in the April 3 issue of JNCI

...inhibitor depsipeptide FR901228 (FK228) is a novel antitumor agent in early clinical development for its toxic effects on tumor cells. However, the mechanism for this effect is unknown. Xiaodan Yu, David S. Schrump. M.D., and colleagues from the National Cancer Institute found that, in addition to promoting hi...

DNA vaccination places tumors in double jeopardy

..., some of which make it particularly appealing for antitumor vaccination. First, this protein can be cleaved in...seen if this form of combined antiangiogenesis and antitumor immunity can be applied more generally by fusing calreticulin to other tumor antigens....

Cell Genesys reports antitumor activity in Phase I/II GVAX lung cancer vaccine trial

...ine trial which demonstrates objective evidence of antitumor activity including a major response rate of 18 per...X vaccines have demonstrated objective evidence of antitumor activity in all five types of cancer in which they have been testedlung, prostate, pancreatic, kidne...

New mechanism of drug resistance found in cancer cells

...ce but insufficient to have an antitumor effect of its own, could increase the effectiveness of chemotherapy in mice with human lung tumors. They found that the chemotherapy alone reduced the size of the tumors, but it did not eli...

Novel antiviral drug concept targets number of human viruses

...s sponsored by the National Cancer Institute as an antitumor agent. Although these trials are investigating a different clinical goal, they have already shown the safety of flavopiridol at doses substantially higher than those thought to be necessary for antiviral treatments. For this reason, data from these t...

Bionumerik reports data on two novel supercomputer engineered anticancer agents

...m and taxane administration without inhibiting the antitumor activity of these agents. BioNumerik's Kareniteci...mptothecin-like agent that has demonstrated potent antitumor activity in several preclinical models including human cancer cell lines and animal bearing human tu...

AVAX Technologies' AC Vaccine™ improves relapse-free survival

...articularly difficult model in which to achieve an antitumor response. Currently, we are collaborating with the University of Tokyo to evaluate the application of our vaccine to the treatment of breast cancer in a study, which is the equivalent of a Phase1/2 in the U.S. This strategy follows our continued ob...

Rockefeller University researchers discover immune-cell mechanism that boosts therapeutic antibody potency

...evelopment," Ravetch says. "The assumption guiding antitumor therapy has been that there are specific molecules needed for tumor-cell growth, and if you want to stop the tumor you definitely have to target those molecules. Now we're learning that how the antibody binds to the tumor cell may be far less importa...

Novel anti-cancer agent shows minimal side effects with preliminary evidence of tumor shrinkage

...nt, called CCI-779, is well-tolerated and may have antitumor activity. CCI-779 is a derivative of rapamycin, an immunosuppressive agent. Results were presented at the International Conference on Molecular Cancer Therapeutics - Discovery, Development, and Clinical Validation, sponsored by the American Associa...

Blocking VEGF can enhance radiation therapy

...n either anti-VEGF or radiation therapyalone. "The antitumor effects were greater than additive," note the authors. "Even aslight inhibition of VEGF action can result in a marked increase in theantitumor effect of ionizing radiation." For example, giving mice with Lewis lung carcinoma a small dose of anti-VEGF...

Wistar Scientists Define Mechanism Of Action Used By Potential Magic Bullet In Cancer Treatment

...stance problems,and design other types of nontoxic antitumor drugs that target the sameprinciple....

1 2

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded