Tag: "applicable" at biology news

Continuing Research On Knee Surgery For Horses At Colorado State University Holds Promise Of Helping Humans With Osteoarthritis

...es with osteoarthritis--missing cartilage--also is applicable tohumans as well, said Dr. Wayne McIlwraith. That's significant, because nearly 21million Americans suffer from osteoarthritis. After heart disease, it's thesecond leading cause of long-term disability in the United States. McIlwraith, a sur...

National Laboratory, National Parks And Forests Leaders Seek To Share Resources

...o presented INEEL projects that don't appear to be applicable now,but may be in the future. These included work with various chemical separationtechniques such as novel filter membranes and technologies under developmentthat can sample the air or ground for chemicals. Such environmental monitoringtechnology wil...

Researchers Propose A Revolutionary New Theory About The Way Cells Communicate

...lamelanogaster, but, they say, the theory could be applicable to some types ofcell communication in many life forms. The researchers were investigating the way in which cells communicate with oneanother about how to develop from the unspecialized cells that followconception, to the specialized cells that make u...

Evolutionary genetic tools trace cancer clone lines

...l biology andthinking that the techniques might be applicable to oncology, made contact withTavare, an international authority on development of computational techniques inmolecular evolution. Extensive meetings were necessary to make the experiment work: "He knew solittle about the way tumors grow, and I knew...

Maybe you can get blood from a turnip after all

... transplanting applicable human genesinto tobacco plants and producing blood factors. Patents are pending onthe production and composition of plant-derived human blood coagulationfactors. Pacific No...

IFT experts inform and caution consumers about dietary supplements

...[but they are now] exempt from additiveregulations applicable to conventional foods," note summary authors Mary EllenCamire, Ph.D., University of Maine, and Mark A. Kantor, Ph.D., University ofMaryland. Unlike drugs and additives, which must undergo rigorous scientifictesting for safety and efficacy a...

New technique identifies M. tuberculosis genes

... Using an elaborate new technique that is widely applicable to a host ofdifferent research situations, James Graham, Ph.D., a post-doctoral researcherin Clark-Curtiss' lab, captured DNA complementary to messenger RNA (called cDNA)of genes active in human macrophages, cells that engulf and degrade pathogenicba...

First results of male osteoporosis treatment study

...study presents the first documentation of a widely applicable treatment forosteoporotic men. There were also no significant side effects from the drug,which acts to reduce the natural rate of bone resorption. While alendronate hasbeen approved by the Food and Drug Administration for use in women, it couldtake y...

MIT team reports powerful tool for studying sugars

...locks (they focused on HLGAG, but the technique is applicable toother sugars as well). Each code is not only easily read by computers, but alsoindicates specific characteristics of each building block (for example, thenumber of key chemical groups in each). "Now I have a sample in front of me, and the objectiv...

Biodiversity yields dividends, finds pan-European research

... range of European grasslands, making the findings applicable on a continental scale. Concentrations of soil water nitrate were higher than the European official limit for drinking water under situations of low diversity. Functional characteristics of plant species - especially the ability to fix nitrogen - pla...

Novel antiviral drug concept targets number of human viruses

...n animals and, eventually, in humans, it should be applicable against many different kinds of viral infections." Schang emphasizes that a good deal of work remains to be done before the new approach can be validated as a viable treatment for viral infections in humans. Until now, antiviral drugs have sought...

Role of key protein that may stave off inherited form of Alzheimer's disease discovered by UC Irvine researchers

...rmation gained from this finding can eventually be applicable to understanding the causes of all forms of Alzheimer's disease." Early-onset familial Alzheimer's disease is responsible for between 5 percent and 10 percent of all Alzheimer's cases; roughly 50 percent of those are due to presenilin mutations. I...

Defense Department awards Stanford nearly $5.3 million for a 'revolutionary' biosciences project

...ectronic circuit design and control theory will be applicable to these genetic networks as well. "Furthermore," he adds, "there are matters at the frontier of electrical engineering research that relate to problems that evidently have been solved by biological systems, such as the design of circuits with many c...

University of Pittsburgh reports best gene delivery to date of protein missing in Duchenne Muscular Dystrophy

...ntly developed in Dr. Xiaos laboratory may also be applicable to other genetic disorders involving unusually large genes, according to the Pitt researchers. Considered the most common genetic ailment, Duchenne Muscular Dystrophy, or DMD, is an X-linked disorder that strikes one of every 3,500 boys worldwide. It...

Dendreon identifies novel approach to improve immunization efficiency

...ancer." The methodology described in the report is applicable to the development of a variety of vaccines and highlights a method for generating a strong immune response with a small amount of antigen. Dendreons current vaccine products in development utilize a proprietary Antigen Delivery Cassette technology t...

Researchers craft model that provides reasons for climate-change observations

... have a lot of variables because that's not a very applicable model." As a result, Post and his collaborators believe they have crafted a model with great utility that provides a tool for a new approach to the study of ecological responses to climate change. "It's an important development in terms of climat...

With HIV rising, UMBI tailors vaccine for Nigeria

...he candidate Nigerian HIV-1 vaccine is potentially applicable to all of Africa, said Agwale, because the IHV team has also included a piece of DNA from the C clade variation of HIV-1, which is rapidly becoming the predominant subtype of HIV-1 in many African countries. He said that technologies developed at the...

Ovarian stimulation in mice adversely affects embryo development and implantation

...around the implantation of the fetus might also be applicable to humans."...

UC Berkeley chemists detail secrets of ionization, reasons behind water's central role in chemistry of life

...that should be measurable. The technique should be applicable to many processes now impossible to measure experimentally because they are rare and, until now too, difficult to calculate. Co-author Christoph Dellago, now at the University of Rochester, N.Y., and Peter Bolhuis, another former post-doc now a facul...

Polymer gel holds promise for therapeutics delivery and tissue engineering

...ng to the American Cancer Society. The gel may be applicable as an improved therapy for early-stage prostate ca..., the three-dimensional cell culture system may be applicable to support future tissue engineering processes, such as the cultivation of stem cells from non-embry...

1 2 3 4 5 6 7 8

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan