Tag: "assistant" at biology news

Hurdle In Ulcer Vaccine Development Cleared

... cancer," says ThomasBorén, D.D.S., Ph.D., an assistant professor of oral biology at Umeå Universityin Sweden. Borén headed the research team, which published its findings in theJan. 16 issue of Science. When Borén was at Washington University School of Medicine in St. Louisin 1993,...

Emory University Fragile X Group Receives NIH Program Grant

... including Drs. Warren and Sherman; Ye Feng,Ph.D., assistant professor of biochemistry; Judy Fridovich-Keil, Ph...professor of genetics; Steven Hersch, M.D., Ph.D., assistant professorof neurology; Daniel Reines, Ph.D., associate professor of biochemistry; andKeith Wilkinson...

Gene Therapy Enables Transplantation Without Immunosuppressive Drugs

...systemic and lifelong," says Kim M.Olthoff, MD, an assistant professor of surgery and lead author on the study."So, to protect the new organ from rejection, long-term drugs that suppress theentire immune system must be given, making the person susceptible to infections,cancers, and a number of other complicati...

Worm Wizardry: World's Most Heat-Tolerant Creature Suggests Enzymes For Drugs OrIndustry, UD Prof Says

... directed by molecular biologist Craig S. Cary, an assistant professorin UD's College of Marine Studies, is believed to be the first report of a"eukaryotic metazoan" or higher-order life form capable of surviving sustained,long-term exposure to temperatures up to 176 degrees Fahrenheit (80 degreesCelsius). Cam...

Salve From Serpents? UD Studies May Explain Why Viper-Venom Protein Stops Tumor Spread In Mice

...ility in mice." WithUD colleague Mary E. Miele, an assistant professor of medical technology, McLanealso plans to study eristostatin's effect on metastatic melanoma cells. Eristostatin is one of many viper-venom "disintegrins"--proteins that interactwith a family of cellular receptors called integrins, McLane ...

B-Vitamins Lower Homocysteine Levels In The Blood; May Reduce Vessel Damage In Stroke Patients

...ltimore Veterans Administration Medical Center and assistant professor ofneurology and geriatrics at the University of Maryland. "It is remarkable thatonly three months of vitamin therapy can produce these kinds of changes." High levels of homocysteine, which result from the metabolism of theamnio aci...

At Life's Most Sensitive Stage, Embryos Cope With Stress

...heat shock proteins at thesymposium. Hofmann is an assistant professor of biology at the University of NewMexico-Albuquerque. Her research highlights the tradeoffs for embryos. Shestudies survival strategies in the intertidal zone, where temperatures in asingle day range from the chill of ocean waves to the su...

Williams Biology Prof. Receives NSF Grant For Work On dUTPase

...n has awarded a grant of$266,191 to Nancy Roseman, assistant professor of biology, for her work ondeoxyuridine triphosphatase (dUTPase), an enzyme involved in DNA metabolism. Roseman uses the vaccinia virus as a model to understand viral/host interactionsand to study the biochemistry of dUTPase. Because th...

$2 Million Dollar Grant Funds Salton Sea Web Site

...ct manager for the Salton Sea Database Program and assistant professor ofenvironmental studies. "If nothing is done to address the problems, the SaltonSea could be a dead sea in about 15 years." The Salton Sea Database Program is funded by a $2 million grant administeredthrough the Environmental Protection Age...

Scientists Invent Faster Gene Function Identification System

...ecular and cellular biology, and Xiaozhuo Chen, an assistant professor in theCollege of Osteopathic Medicine, both working with Wagner at the EdisonBiotechnology Institute at Ohio University. Contact: Thomas Wagner, (614) 593-4713; twagner2@ohiou.edu . Written by Kelli Whitlock, (614) 593-0383; kwhitlock1@oh...

Researcher Identifies Two New Violet Species In Central America

...of very primitive violets," saidHarvey Ballard, an assistant professor of environmental and plant biology atOhio University. "It's likely their group predates the last Ice Age in CentralAmerica." The violets were discovered some time ago growing in parts of CentralAmerica, and were classified as existi...

Drug-Resistant Infection Once Found Only In Hospitals Now Present In Community

...reating theinfection," said Betsy C. Herold, M.D., assistant professor of pediatrics at theUniversity of Chicago and lead author of the study. "First-line antibiotics arestill the best therapy for these infections." The University of Chicago researchers conclude that the results of this studyunderscore the nee...

Studies Underscore Link Between Nutrition And Nonmelanoma Skin Cancers

... adermatologist and University at Buffalo clinical assistant professor in thedepartments of Social and Preventive Medicine and Dermatology. Primary among these factors, Arbesman said, are dietary fat andantioxidant vitamins and minerals. Half of all new cancers diagnosed in the U.S. are sk...

Study Links Viruses And Vascular Diseases

...ys senior author Herbert W. Virgin, M.D.,Ph.D., an assistant professor of pathology, molecular microbiology and medicine."But now we have a better idea that it may be possible, and we know whichviruses might be involved." The discovery at the School of Medicine echoes recent studies that suggest alink between ...

PEBBLEs Help U-M Scientists Open A Window On Cell Chemistry

... in control cells." Martin A. Philbert , U-M assistant professor of toxicology in the School of Public...ved in the research project include Brian Athey , assistant professor of anatomy and cell biology in the U-M Medical School ; U-M graduate students Alex Ade,...

Discovery By Fertility Specialist Offers Promise Of Reducing Multiple BirthsTied To Fertility Treatment

... ovulation, said Michael W. Sullivan, M.D., UB assistant professor of gynecology and obstetrics and lead researcher on the study. They have important implications for women undergoing fertility treatments, Sullivan said, because spec...

Dog Blindness Gene May Help Humans

... Amelia Langston, formerly at Hutchinsonand now an assistant professor at Emory University. The prcd study at Cornell University was supported by the Morris Animal Foundation, Seeing Eye, the National EyeInstitute and the Foundation for Fighting Blindness. Ostrander's work was supported by a grant from the Can...

UPMC Researchers Report On Gene Therapy Advances

...on muscle injuries," commented Johnny Huard,Ph.D., assistant professor of orthopaedic surgery, University of Pi...e bonefractures," commented Chris Niyibizi, Ph.D., assistant professor of orthopedicsurgery, University of Pittsburgh, who heads this research. Treatment for gr...

Jefferson Researchers Use Gene Therapy To Treat Rare, Inherited Brain Disease

...essor of neurosurgery, Paola Leone, Ph.D., adjunct assistant professor of neurosurgery, and Giancarlo Barolat, M.D., professor of neurosurgery, as well as their colleagues there and at Yale University. Canavan disease is an inherited neurological disorder characterized by spongy degeneration of the brain. It ...

New Gene Therapy Technique Results In 60 Percent Tumor Regression Rate

...ts, saysXiao Chen, lead author of the study and an assistant professor of clinicalresearch at Ohio University's Edison Biotechnology Institute and College ofOsteopathic Medicine. The work was published in the latest issue of the journal Human GeneTherapy, published March 20. "Viral gene thera...

1 2 3 4 5 6 7 8 9 10

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting