Tag: "auto" at biology news

Study concludes environmental management systems can boost performance, compliance

...ying several thousand U.S. companies supplying the auto industry to see what difference it makes to firms when their industrial customers require EMSs....

MIT study: Hydrogen car no environmental panacea

...mmend stopping work on the hydrogen fuel cell. "If auto systems with significantly lower greenhouse gas emissions are required in, say, 30 to 50 years, hydrogen is the only major fuel option identified to date," said Heywood. The hydrogen must, of course, be produced without making greenhouse gas emission...

QuikClot (TM) will be made available to public

...that 50,000 Americans die each year at the site of auto accidents because of uncontrollable bleeding. As head of ONR's Casualty Care and Management program, Given is providing funding for research on a remarkable granular mineral compound called QuikClot TM , developed by Z-Medica, Inc. ( www.z-medica.c...

Scientists at TSRI create new strain of yeast with 21-amino acid genetic code

...tion by introducing an unusual car design onto the auto market and by embracing factory mass production of his "Tin Lizzie." Now a team of investigators at The Scripps Research Institute (TSRI) and its Skaggs Institute for Chemical Biology in La Jolla, California is introducing revolutionary changes into ...

Waste motor oil management may pose threat to health and the environment

...exist now and are available to the public. "If the auto manufacturers put these on new cars and called for these at each oil change, the used oil volume could be reduced by half from the transportation sector," Boughton says. Jason Gorss...

Study reveals poor Houston air quality

...al complexes in the area, plus the large amount of auto exhaust in Harris County. The highest ozone levels... because of the industrial emissions, coupled with auto exhaust. It creates very big problems for Houston's air, and ozone levels are far above acceptable f...

World's largest scientific society convenes regional meeting June 2-4 in Indianapolis

...s of interest to the public include: Chemistry of auto racing Studies on Alzheimer's disease Chemical a....in.us ) Friday, June 4: The chemistry of auto racing From the Indianapolis 500 to the Brickyard 400, auto racing rules in Indy. A special sympos...

1 2

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue