Tag: "basis" at biology news

American Chemical Society media registration

...from the meeting will be available on an embargoed basis approximately one week before the meeting on EurekAlert at www.eurekalert.com and other science news websites. The ACS web site -- www.chemistry.org/news --will post the releases once the embargo is lifted. Housing and Travel Arrangement informati...

Other highlights in the July 7 JNCI

...nto the study design and rarely formed the primary basis for dose selection. The authors conclude that although phase I studies of targeted anticancer agents in general continue to use traditional endpoints for selection of the recommended phase II dose, suitable molecular measures of drug effect and the ...

EC boosts European electron microscopy research

...sitory for EM structures and provide the essential basis for a comparability of data and their facilitated exchange. Standard data formats and validation standards will be developed according to the demands of the 3D-EM consortium in close collaboration with existing structural databases in the EU and USA....

Chemoradioimmunotherapy for advanced breast cancer: hope for the future?

...tic tests were employed to determine the molecular basis for the observed success of the chemoradioimmunotherapy treatment. The tests proved that the novel regimen had specifically impacted on the identified oncogenes that are essential to the propagation and perpetuation of the tumour cells. Evidence was ...

Survival strategies in nature

...s are both components of ecosystems as well as the basis for the nutrition of an increasing world population. However, plants permanently cope with attack from thousands of insect and microbe species, and consequently have evolved complex strategies to repel these attackers. A detailed understanding of the...

Donaghue Women's Health Investigator Program awards grants to three at Yale

...entists have generated pilot data establishing the basis for further studies and findings that could be immediately applied. Based on data from these studies, program investigators have received over $15.5 million of new external research funding for their laboratories, including many research and trainin...

Joslin researchers identify key molecule in Type 1 diabetes progression

...uctive. "Understanding the molecular and cellular basis of the immune regulation in the lesion might some day lead to the development of therapies that favor regulatory T-cells and respectful insulitis, preventing the development of full-blown diabetes even after insulitis has developed," Herman explains....

Clinical judgement still counts strongly alongside genetic testing

...not yet available with which to make their genetic basis visible. What we have found is that other, clinic-based techniques and technologies, such as photographs and family trees, have developed with which to do genetic profiling, and which help in distinguishing genetic conditions from other kinds of prob...

Lupus Research Institute awards $3 million in novel research grants to further new science in lupus

...will investigate whether antibodies are always the basis of kidney disease in lupus, or whether there are other populations of T cells that can trigger the disease process, a very important question for the lupus community. He will also determine whether there is a relationship between the patient's gender...

Existing drug may prevent brain injury and seizures in newborns

...ldren over age 3, but the findings may provide the basis for a protective therapy that could be given to babies immediately after traumatic birth events that compromise the brain's blood and oxygen supply. Such events can cause long-term neurologic abnormalities that underlie serious conditions like cerebr...

Scientists receive awards, give lectures at the ASBMB/IUBMB meeting

... p.m. Monday, June 14. He speaks on the structural basis for T-cell costimulation. Dr. Almo is known world...ral biology of the cytoskeleton and the structural basis for the immune response. His group solved the structures of the molecules responsible for attenuat...

Canine word-learning research published in Science

...ue to humans, and may have formed the evolutionary basis of some of the advanced language abilities of humans," said Katrina Kelner, Science 's deputy editor for life sciences. The German team first verified Rico's 200-word "vocabulary." In a series of controlled experiments, Rico correctly retrieved, by ...

Carnegie Mellon computational biologist Russell Schwartz receives prestigious CAREER award

...ational tools. CAREER awardees are selected on the basis of creative career-development plans that effectively integrate research and education within the context of their institution's mission....

New laboratory model can be used to test new treatments for pediatric eye cancer

...s the potential to teach us more about the genetic basis of other cancers as well." Other authors of the paper are Jiakun Zhang, M.D., Ph.D., and Brett Schweers, Ph.D., both of St. Jude. ...

Carnegie Mellon U biologists identify critical player in yeast ribosome assembly

...e at Carnegie Mellon. "Understanding the molecular basis of ribosome assembly offers a rational scheme for designing drugs to interfere with that process." A complex of protein and ribonucleic acid (RNA), ribosomes are present in vast quantities inside every cell. There, they translate genetic information...

Yale professor receives Johnson & Johnson Focused Giving award

... With this grant Altman's group will pursue the basis of their observation that directly inhibiting expression of one of the protein subunits (Rpp38) in human nuclear RNase P turned off the expression of some, but not all, subunits without further cell manipulation. The research will use e...

Loss of circadian genes results in epilepsy

...r lead to breakthrough new insight on the genetic basis of epilepsy. Circadian rhythms -- the normal ups and downs of body rhythms help organize physiological processes into a 24 hour cycle, affecting everything from body temperature, hormone levels and heart rate, to pain thresholds. Scie...

Study links diabetes and colorectal cancer

...sulin resistance, glucose and colon cancer, on the basis of the fact that insulin promotes the growth of colon cells and colon tumors. Both diabetes and colorectal cancer may share common predisposing factors. For example, a high-fiber diet and regular exercise may protect against both diseases." Previou...

VIB presents its annual results at BIO2004 in San Francisco

... new technologies and inventions that can form the basis for new social and industrial applications, including medical diagnostics and medicines. To bring these applications into being, VIB protects its findings via patents: in 2003, 30 discoveries were sufficiently new and inventive to warrant patent appl...

UCSD study shows how we perceive world depends on precise division of labor among cells in brain

... of the brain will help us understand the neuronal basis for sensation and cognition and their associated disorders." In their paper, the UCSD researchers also determine a chain of physiological mechanisms working in concert to allow these brain neurons to selectively respond to a specific pattern of incom...

1 2 3 4 5 6 7 8 9 10

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement