Tag: "beans" at biology news

New research suggests link between maternal diet and childhood leukemia risk

... groups, certain foods - including carrots, string beans and cantaloupe - stood out as having stronger link... and foods containing protein, such as meat, fish, beans and nuts, may protect the health of their unborn children." The few studies that have been con...

Body's own defense against H. pylori, cause of stomach ulcers and stomach cancer

...sible to breed cows and genetically engineered soy beans from which it would be possible to produce milk bearing the inhibitory O-glycans capped with alpha 1,4-linked N-acetylglucosamine. This offers an inexpensive way to help people suffering in less developed countries. Says Dr. Fukuda, "If we could ...

Protein vaccine fully protects mice from lethal aerosol challenge with ricin toxin

...rposes. Approximately one million pounds of castor beans are used each year in the process of manufacturing castor oil. When inhaled as a small-particle aerosol, ricin produces severe respiratory symptoms followed by respiratory failure within 72 hours. When ingested, ricin can cause severe gastrointesti...

Trapping carbon in soil key for protecting global food security, dealing with climate change

...-growing season produced about 1 ton of maize and beans per hectare (a hectare is about the size of two football fields). But fields treated with manure, planted with cover crops and covered with mulch yielded six times that amount. "This is the type of quantum jump in crop yield needed at the continental...

'Telling people what they want to believe'

...ydrates: eating a diet rich in fruits, vegetables, beans (including soy products) and whole grains like brown rice and whole-wheat flour. "These foods are rich in fiber, which enhances fullness without adding significant calories," Ornish writes. In the article, Ornish looks at evidence that comple...

Scientists develop new cloning technique that dramatically shortens the search for genes

... legume family that is closely related to alfalfa, beans and peas. "Over the course of six months, we completed what took another group several years to complete, and we identified a pretty cool gene to boot," said Stanford postdoctoral fellow Raka M. Mitra, lead author of the PNAS study. "We think this te...

University of Toronto professor turns hemp into auto parts

...owever, if it is mixed with plastics made from soy beans or pulp and paper sludge, researchers can create tough biocomposites that are completely biodegradable. Finally, using a combination of heat and pressure, they compressed the material into a variety of shapes. While these studies used hemp, the proce...

Underwater sensor system could protect reservoirs, drinking water

...icin, the highly poisonous protein found in castor beans and thought to be a potential terrorism agent. Sensors also exist for other harmful chemicals. In the aqueous sensor network system an uplink node floats on the water's surface and transfers the aqueous network data from the water to the air, where...

Space Shuttle returns first soybeans grown on Space Station in commercial farming experiment

...family and friends this summer, she reported, "The beans looked mature and the leaves are turning brown." The plants and seed pods were turning brown because scientists wanted them to dry out and be preserved for tests on Earth. It turned out to be a very good crop. "The first soybean crop grown in spac...

Increased fiber curbs appetite in women

Everyone knows that if you eat a plate of beans or a bowl ofbran cereal, you're likely to get full pretty quickly. UCDavis nutrition researchers now have a better idea why. A UC Davis study, published recently in the American Journalof Clinical Nutrition, indicates that increased fiber contentin a...

Study: Isoflavone-enriched soy proteins fail to increase bone mineral density in young women

...tion and organisms that might attack them, and soy beans are an especially good source. "We had seen earlier reports that isoflavones had beneficial effects on the bones of women undergoing menopause or who already were postmenopausal," said Dr. John J.B. Anderson, professor of nutrition at the UNC school...

Exposure to toxin in certain foods could cause testicular cancer

... results from molds that grow in grains and coffee beans and is found in animals that consume moldy grain, especially pigs. "Little is known about the etiology of testicular cancer, which is the most common cancer among young men," said Schwartz, associate professor of cancer biology and public health sci...

Genetic marker tells squash domestication story

...the New World. As one of the three sisters (corn, beans and squash) cropping system, squash is prominent i...st of Sky Woman, squash springs from her belly and beans grow from her hand. For the last two decades, scientists have pushed to fill in many gaps in the h...

NSF awards two plant genome grants to University of Minnesota

...ion of legumes and grain. In Middle America it was beans and corn, in the Far East soybeans and rice and in Africa cowpeas and sorghum." Legumes such as peanuts and soybeans are valuable sources of oil, and legumes also contain unique "phytochemicals" like isoflavones, which seem to promote heart health. S...

Scientists map the complete genome of an important agricultural bacterium

...her alternative to fertilization is to breed peas, beans and other legumes that can produce large yields in nitrogen-poor soils. "We can improve symbiotic plants by breeding more efficient, stable and ecologically versatile crops," Long maintains. "Knowing the sequence of the S. meliloti genome is going to...

ASM journals tipsheet: May 2001

...ntal Microbiology. The curing process for vanilla beans is complex and slightly varied according the count...re produced. Essentially it involves scalding the beans and then a 5 to 10 day process of "sunning and sweating" in which the beans are left in the sun all ...

The enemy of my enemy is my friend

... the volatile chemicals released from lima beans after damage by spider mites (Dicke, et al. 1990). Fig. 1: The VOC release is frequently quite specific and is elicited in the plant by herbivore-specific salivary chemicals. I...

Florida research shows that for rice, warmer earth brings uncertain future

...to declines in yields of peanuts, soybeans and dry beans such as kidney beans. "I think we've demonstrated...eans, peanuts and dry beans, although rice and dry beans appear the most sensitive to temperature change, Allen said. The news, however, is not necessarily ...

Conservation under the shade coffee canopy: ant-bird interactions in Panama croplands

...asingly fashionable among American consumers. The beans are produced and harvested under trees in Central and South America, and the product is generally believed to be more environmentally friendly than the process of growing coffee in open sunshine. Tropical birds, it has been assumed, are better able ...

The glycemic index: Rethinking diet and cardiovascular risk

... insulin 2 or 3 hours after eating, others such as beans and legumes break down more slowly and produce a more gradual rise in glucose and insulin in the bloodstream. An individual's glycemic load is based on the carbohydrate content of each food measured by its glycemic index, multiplied by the frequenc...

1 2

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting