Tag: "bed" at biology news

Scientists urge that the patient physical should now include this advice: 'Get off the sofa and get active'

...hildren. Aging Americans who settle for a life of bed rest may be signing on to an early death warrant. ... recent study found that three weeks of continuous bed rest by healthy volunteers was associated with muscle wasting, bone loss, insulin resistance, a redu...

'Night eating syndrome' may be related to the performance of the body -- not the mind

...ls in plasma were measured. The subjects stayed in bed during the observation period. Blood was collected in precooled glass tubes containing 20 mmol EDTA and 1,000 KIU aprotinin) per milliliter blood and were kept on ice until centrifugation at 4C and storage at -27C. Cortisol and ACTH were then measu...

The body's production of melatonin may be the reason why the elderly can't get a good night's sleep

...included recording and averaging habitual wake and bed times from the sleep diary for the seven nights im...he older subjects was such that they were going to bed earlier with respect to melatonin onset and waking earlier with respect to melatonin offset. These r...

December Media Mighlights: GEOLOGY and GSA TODAY

... Pattern of vertebrate extinctions across an event bed at the Permian-Triassic boundary in the Karoo Basi...outh Africa have revealed the presence of an event bed coinciding with a mass extinction of terrestrial fauna and flora. This occurs within a sedimentary s...

Gender issues related to spaceflight: A NASA perspective

...ght between men and women. However, in response to bed rest, the relative changes in aerobic capacity are...ing strength changes in women after spaceflight or bed rest. Regional decreases in muscle volume were similar in two men and two women after eight days of...

Hopkins' emergency extended care unit reduces overcrowding

... 20 percent were held in the unit until a hospital bed became available, and the rest received treatment in the unit. Thirty-two percent of patients seen in the unit ultimately were admitted to the hospital. "Many administrators feel that any extensions of space must be adjacent to the ED or on a groun...

Lilly Endowment grants almost $26 million to Purdue Discovery Park

...t partners, the center will be an interactive test bed that will combine computer models with human behavior at various levels (from strategy formulation to operations management) in a real-world environment. A key component will be the design and development of computer security tools. "This center is o...

Exercise effects dependent on time of day

...." When not exercising, the subjects rested in bed with constant glucose infusion to avoid fluctuation in their blood sugar levels caused by intermittent meals. Blood levels of the "circadian hormones," melatonin, cortisol and thyrotropin, and the levels of growth hormone and glucose were compared to...

Lipoprotein lipase: Location, location, location.

... is only transiently associated with the capillary bed and is rapidly shed into the bloodstream. Not all of the released protein is inactive, so lipoprotein metabolism begins in the bloodstream of transgenic mice. The generation of fatty acids within the circulation, rather than in the muscle and other...

How cells know when to stop wound-healing

... cells move into the wound, they lay down a sticky bed of proteins including laminin 5. The chemical signals dissipate as the wound heals, but to fine-tune their position the cells now use alpha(3)beta(1) to crawl over the laminin 5. At some stage, however, the cells need to stop moving and settle down...

Why missing out on a good night's sleep could give you ulcers

...olunteers all ate at 1.15 pm and 5.15 pm, went to bed at 11.30 pm, and were all asleep by 1.00 am. Samples of their gastric juice were collected every two hours during the study. TFF2 levels followed a circadian rhythm. They were lowest during the afternoon and early evening, rising gradually between 7 ...

Vapor-recovery system captures and recycles air pollutants

...rom the booth would be blown through an adsorption bed containing a number of cylindrical cartridges of activated-carbon-fiber cloth, which would trap the solvent. To release the solvent, an electric current passes through the fabric, allowing for rapid heating, Sullivan said. The solvent boils off the ...

Advances in animal medicine increase quality of life for older pets

...mbing stairs; jumping up into the car, or onto the bed or sofa. "Owners may attribute these problems to old age and may not seek veterinary advice, yet we have some options that may help," Fortney said. "We start with NSAIDS -- nonsteroidal anti-inflammatories. They provide a more predictable response, ...

New shoes for speed freaks

...Wakeling's team strapped subjects onto a suspended bed with their feet held at a steady angle to the wall. The bed was then swung like a pendulum so that their heels struck the wall every two seconds. By measuring e...

Putting medical research on-line to give patients the information they need

...treatment with steroids, while being restricted to bed rest helped prepare the fetus for premature delivery (via emergency cesarean section) at 32 weeks. Jean used Medline, the US Government's National Institutes for Health (NIH) abstract archive, to locate the research articles that were relevant to her...

Study: Methane cleans nitric oxide from power plant emissions

... form and function, the catalyst bed resembles the inside of an aut...anies much. "The same catalyst bed design common in power plants today can be used with this new formulation," she ...

Dominant birds stay leaner than their subordinates, study finds

...hat dines just before going to bed has the real advantage. A new study has found that socially dominant birds are generally leaner than their subordinate peers of the same species, probably because they can eat when they wan...

Heat can help maintain muscle mass in immobilized limbs, study shows

...limbs immobilized because of bone injury or during bed rest as well as for astronauts, whose muscles ofte...ed. "If an 80-year-old breaks a hip and goes to bed for six to eight weeks, he or she may never be able to walk again," Powers said. "This may have part...

Discovery of oldest dinosaur bones reported in Science

...mains of eight other prehistoric animals,in a rich bed of fossils in Madagascar, providing a 'time capsule' from theearliest days of dinosaurs and mammals and illuminating scientific understandingof the mid-late Triassic Period. The findings are reported in the October 22issue of Science. "We hav...

Search and support for the rare white abalone is on; sex must occur with close neighbors

... success lastweekend when divers located a healthy bed of reproducing white abalones, located in the Tanner Banks, about 50 miles away from San ClementeIsland. Until now most of the few remaining animals that have been located inthe wild were too far apart from each other to reproduce. The fisher...

1 2 3 4

(Date:7/25/2014)... (PRWEB) July 25, 2014 AttorneyOne.com, a recognized ... latest information from the FDA on Ibuprofen and Oxcarbazepine ... that one lot of Ibuprofen and one lot of Oxcarbazepine ... due to mislabeled packaging. Oxcarbazepine is used for the treatment ... , The reason for the recall is that Lot ...
(Date:7/25/2014)... July 25, 2014 Parker Waichman LLP, ... of consumers comments on a recent tobacco lawsuit in ... smoker $23.6 billion in punitive damages. Cynthia Robinson brought ... cigarettes. The case is Cynthia Robinson v. R.J. Reynolds ... Florida First Circuit Court, Escambia County, Florida; Case Number ...
(Date:7/25/2014)... Drexel University College of Medicine is pleased ... been appointed vice dean for education, effective October 1, 2014. ... Medical College, where she is currently chair of the Department ... of medicine. , As a member of the senior ... major role in many aspects of the development of the ...
(Date:7/25/2014)... vulnerable neurons and reduce motor deficits in a ... University School of Medicine have shown. , The ... Parkinson,s Disease . , The findings demonstrate that ... at sufficient levels and have beneficial effects when ... Previous studies of XPro1595 in animals tested more ...
(Date:7/25/2014)... 25, 2014 The new report ... Feed, Pharmaceuticals and Others), by Type (Amylases, Cellulases, ... Geography - Global Trends & Forecasts to 2019", ... of the global Carbohydrase market with analysis of ... is segmented and values are forecasted on the ...
Breaking Medicine News(10 mins):Health News:Ibuprofen and Oxcarbazepine Tablets Recalled: AttorneyOne Monitors and Keep Consumers Informed 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 2Health News:A Florida Jury Awards Widow More Than $23 Billion in Punitive Damages in a Lawsuit Brought Against Tobacco Maker, R.J. Reynolds, Parker Waichman LLP Comments 3Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 2Health News:Valerie D. Weber, MD, Appointed Vice Dean for Education at Drexel University College of Medicine 3Health News:Anti-inflammatory drug can prevent neuron loss in Parkinson's model 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 2Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 3Health News:Carbohydrase Market worth $3,717.7 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement