Tag: "biogeochemical" at biology news

AIBS tapped to coordinate design of ecological observatories

...f invasive species; the ecological implications of biogeochemical cycles; and hydroecology. NEON will transform the way ecological research is conducted by bringing ecologists and engineers together with social, computer, and earth scientists to investigate important ecological phenomena across large geographical a...

URI oceanographers to build laboratory to study subseafloor life

...ry will be fully outfitted for microbiological and biogeochemical sampling of diverse subsurface environments. The facility will be used to sample subsurface life from diverse marine environments, including estuaries, coastal sediments, and deeply buried sediments and aquifers of the deep ocean. The facility will b...

Model shows long-held constant in ocean nutrient ratio may vary as ecological conditions change

...capture energy from the sun and have a big role in biogeochemical cycles -- how elements cycle through the biosphere...dy contributes to a better understanding of global biogeochemical cycles. "It's important for us to understand global climate and how it might change in the future," ...

The American Academy of Microbiology releases report

...ls. Most interactions, evolutionary processes, and biogeochemical activities in microorganisms occur at the community level and have immense impacts on human health and the planetary biosphere. Although genomic analysis of individual strains has had a significant payoff, progress can be significantly accelerated by...

NSF awards $31.9 million in grants to study biocomplexity in the environment

...ervation of ecosystem processes; test a land-ocean biogeochemical observatory for nutrient and carbon cycling; and d...e, unattended monitoring of chemicals important in biogeochemical cycling. MUSES investigators will study sustainable materials use for drinking water infrastructure...

The American Academy of Microbiology releases report

... locations of individual members. From the major biogeochemical cycles to medical implications and possibilities for new commercial applications, microbial communities affect our lives in innumerable ways. Yet, many of these functions and potential applications involve microbes about which we know little, that ha...

Microbes active in Colorado snows fuel tundra ecosystem

...etabolism of snow-covered microbes is an important biogeochemical "sink," or way of storing, nitrogen. "The subsequent release in spring of nitrogen from the microbes' metabolism is a major contributor to the relatively high productivity during the short growing season in the tundra," said Steven Schmidt of the Un...

New Colorado U. study shows increase in fungal metabolism under the snow

...oadens our understanding of both the diversity and biogeochemical functioning of fungi in cold environments," the researchers wrote in Science. The types of fungi and other microbes under the snow in winter and spring on Niwot Ridge are different than microorganisms found in the cold soils during the summer months,...

Story tips from the Department of Energy's Oak Ridge National Laboratory, September 2003

... snow-covered microbial metabolism is an important biogeochemical sink for nitrogen, and the subsequent release of microbial nitrogen in the spring is a major contributor to high primary productivity during the short growing season in the tundra. Schadt and colleagues at the University of Colorado and San Diego Sta...

Down on the farm

... relationship between soil microbial diversity and biogeochemical cycles and the role diversity plays in pest dynamics Among the line-up of speakers are Laurie Drinkwater, also of Cornell University, Katherine Gross, of Michigan State University, and Russell Greenberg, of the Smithsonian Institution. Drinkwater...

Cincinnati engineering study finds clue to Bangladesh's poisoned water

...en pumped out and creates favorable conditions for biogeochemical reactions that take the arsenic from a safe solid state to an unsafe liquid state, says Islam. One possible remedy that has already begun to be used is to dig deeper wells, Islam and his co-researchers say. Unsafe levels of arsenic are associated wit...

Shifts in rice farming practices in China reduce greenhouse gas methane

... researchers spent more than 10 years developing a biogeochemical model, called the Denitrification-Decomposition (DNDC) model, which would handle all the major factors relating to methane emissions from rice paddies. These factors included weather, soil properties, crop types and rotations, tillage, fertilizer and...

A drop of ocean water tells a story

...n. "Microbes like bacterioplankton are important biogeochemical agents," explained Carlson. "Over geologic time, they have played an important role in altering the chemical nature of the earths's environment, allowing for the evolution of plants and animals. Without them, we would have no oxygen to breathe, organ...

November GEOLOGY and GSA TODAY media highlights

...eaval in marine communities and profoundly altered biogeochemical cycling....

Bacteria point the way to gold deposits

...uggested the possibility of B. cereus serving as a biogeochemical indicator of underlying gold deposits. This bioindex system may help geologists to locate the gold deposits at low cost and with improved efficiency, says Dr. Hongmei Wang of Ohio State University, one of the researchers on the study, which was prese...

URI oceanographer to assess impact of climate change on ocean ecosystems and biogeochemical cycles

...l and predict how the ocean and its ecosystems and biogeochemical cycles will be affected by global physical climate...bal climate change on ocean ecosystem dynamics and biogeochemical cycling, including the carbon cycle, is prerequisite for building the scientific basis for intellige...

Comparing ag and industrial runoff between estuaries

...5 coastal systems globally had been compiled. The biogeochemical budget web site http://data.ecology.su.se/mnode , which contains detailed information about coastal ecosystems, is maintained at Stockholm University. Project scientists are comparing data from the budgets with global data sets of other variables ...

Media Advisory 2 - 2002 Ocean Sciences Meeting: press conferences scheduled

...mate changes have changed circulation patterns and biogeochemical processes in the Pacific Ocean over the last 20 years. Fei Chai presents a 3-D biogeochemical model that indicates that an abrupt climate change that took place in the late 1970s caused dramatic...

New view of bacteria-mineral interface to advance bioremediation

...rch designed to better understand the interplay of biogeochemical processes in the subsurface environment. Improving our understanding of such processes will help researchers develop more effective detection, characterization, remediation, and monitoring technologies. ESRA and LDRD research support the objectives ...

NSF awards $55 million in grants to study biocomplexity in the environment

...r change, and bird diversity; coupling rhizosphere biogeochemical cycles to plant growth under differing levels of carbon dioxide; meta-genome analysis of extreme microbial symbiosis; and developing instrumentation to measure the emission and transport of biological aerosols into the atmosphere. ...

1 2

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue