Tag: "cameras" at biology news

Horseshoe Crab Research Center provides information to improve management

...bility of flying over spawning beaches using video cameras with nightscopes to index the number of spawning horseshoe crabs in the spring. If feasible this technique could supplement time consuming, manpower intensive beach surveys that have proven less than reliable over time. Researchers are estimating...

New U. of Colorado electron microscopes provide cell images never seen before

...electron microscopes also are equipped with better cameras and a special "electron gun" located at the top of the microscope. "This releases a beam of electrons that penetrate the cell slabs, creating a shadow of the organelles inside," McIntosh said. Lab personnel include McIntosh, the principal investigat...

Office of Naval Research awards $8.4M to young investigators

...ble the design of a network of imaging sensors and cameras for surveillance, such as the tracking of human activities in homeland defense. Dr. Scott D. Stoller, Computer Science, SUNY at Stony Brook will be investigating methods for the testing and verification of computer software in distributed heterogeneo...

Stanford scientist seeks participants in NASA hypergravity study

...ing, reading and watching TV. Closed-circuit video cameras will monitor all activities. Each passenger will be fitted with a specially designed biosensor vest to measure his heart rate, blood pressure and oxygen levels. Urine samples will be collected and analyzed at a later date. NASA warns that in addition...

New equine treadmill facility a research, evaluation resource

...ural arrangement which will allow up to five video cameras to be positioned around or over the horse. These cameras will be used to document and analyze subtle gait problems. Information related to heart, respiratio...

New imaging technology promises better breast cancer detection in early stages

...e reduced if the limitations of contemporary gamma cameras were overcome. In one of his studies, Dr. Khalkhali found that three out of four false negatives were in the middle part of the breast and out of range of close camera contact. Dr. Khalkhali is currently pursuing research on improving scintimammogr...

U of C researcher tracks path of flying snake

...gapore Zoological Gardens. He positioned two video cameras to record in stereo, enabling the three-dimensional reconstruction of the head, midpoint and vent coordinates of the snake throughout its trajectory. Socha found that C. paradisi prepares to take off by hanging from a branch looping its anterior body...

Sensing tanks, as well as cancer

...en off by abnormally reproducing cells. A pair of cameras at different infrared wavelengths* transcribed the thermal diffusion process into two images, which were then filtered for shared signals while disagreement noise was minimized. Last February Szu and Buss and their team detected early stage ductal...

DNAs oscillating double helix hinders electrical conduction

...h less well than was previously thought. Ultrafast cameras were one of the devices the researchers from Amste...osecond. To put this into perspective: normal film cameras take 24 pictures per second and only detect the vibration if it lasts longer than 0.02 seconds....

UCLA scientists eavesdrop on cellular conversations by making mice 'glow' with firefly protein

... the same kind of computer chip used in home video cameras to convert light into electrons. The team injected luciferase, the protein that makes fireflies glow, into cells, then injected the cells into the mouse. They saw a remarkable sight. Each time two specific proteins spoke with each other, it activated...

Wildlife researcher captures jaguars with camera

...one bound." Kelly uses infrared remotely triggered cameras to photograph jaguars. Because jaguars have distin...s flash," notes Kelly. Researchers place a pair of cameras every three square kilometers in order to keep track of the jaguars. The cameras are checked once ev...

Aged Polish forest plots teach new ecosystem lessons

...es stands will be observed underground using small cameras inserted in tubes to see how thetrees have grown underground. "The fine roots, which grow every year from the main roots, are as important to trees asnew foliage is," Tjoelker said. "Yet, we as foresters know less about that than other areas of tree...

Male groundhogs hibernate less to visit the ladies

... two years of the study, infrared motion triggered cameras were placed at the burrow entrances. These cameras recorded date and time of emergence as well as supplying a photograph. On average, Zervanos found t...

SRS research highlights from the Red-Cockaded Woodpecker Symposium

...me from examining close to 12,000 photographs from cameras placed at 31 nest cavities at four locations. Five years of data showed that, although RCW were seen preying on over 40 different arthropods, the most common prey fed to nestlings was wood cockroaches, probably selected because they were the most abu...

Larger nuts end up further from tree

...ed with a numbered fluorescent thread. Using video cameras he observed which animals removed the nuts. He then traced the nuts using the threads sticking out of the ground and followed them until they were either eaten or grew into a seedling. He found that the vast majority of nuts were taken by acouchies, ...

Carnegie Mellon, NASA to develop robot illustrating how to seek life on distant planets

...eeds to be able to move into unknown terrain using cameras and internal sensors--the same instruments and information that would be available to a robot exploring Mars." In addition to Wettergreen, the Carnegie Mellon team heading to the Atacama includes William L. "Red" Whittaker, the Robotics Institute's F...

Flipper as Rambo: Dolphins can be great naval security tools

...s and other marine animals are being equipped with cameras and special sensors to detect underwater mines and...y, has been equipping seals and other animals with cameras for 15 years and says dolphins can be a vital security link when it comes to detecting unwanted mate...

Georgia Tech researchers use lab cultures to control robotic device

...vity of the cells and networks by using high-speed cameras and voltage-sensitive dyes, in conjunction with 2-photon laser-scanning microscopy. The team is looking for evidence that the networks are growing and learning over time. "Learning is often defined as a lasting change in behavior, resulting from expe...

Exploring the sights and sounds of a deepwater coral marine protected area off Florida

...at UNCW. This ROV is equipped with video and still cameras and will also be used to collect small coral samples using its robot arm in order to assess the growth and health of the reefs. A key goal for the expedition will be to understand the condition of the Oculina habitat and fish populations and to esta...

Highway deaths highest for males Male urban squirrels, that is

...or squirrel reproduction with the aid of miniature cameras placed in nest boxes and viewable via the Internet."...

1 2 3

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded