Tag: "centres" at biology news

Another small cog in the 'hub' of metabolism unraveled

...aem groups of subunit C via the three iron-sulphur centres and the FAD to the site of fumarate reduction. The high resolution of the structure of the enzyme with the bound substrate fumarate allowed the scientists to propose a catalytic mechanism for the reduction of fumarate to succinate. As all of the ide...

First International Congress on Telehealth and Multimedia Technologies Story Ideas

... four clinics in the world designated as reference centres for trainingand development. At the Congress, two live COMPRU consultations will take placebetween COMPRU co-director Dr. Gordon Wilkes and: Professor Per-Ingvar, a Swedish researcher who pioneered the biotechnology ofosseointegration (placing met...

A Woman's Egg Can Be Freezer Friendly, If You Go Easy On The Salt

...er chance of becoming mothers. Fertility centres routinely freeze sperm and embryos, but only a fewbirths have been reported using frozen eggs. James Stachecki of the Institutefor Reproductive Medicine and Science of St Barnabas Medical Center in WestOrange, New Jersey, wondered if the saline solut...

More Research Needed To Reach Green Goals

...ojects. "These institutes should provide transient centres mustering of strength aroundcertain problems,with a time limit of 5-10 year. They should be headed by active researchers withrepresentativesfrom affected areas, and could be jointly financed by several players, accordingto Erik Fellenius,research dir...

Quicker Implementation Of Research Results

...rsity to regional companies. This is one of eleven centres of excellence which were set up in 1995; theGrants...erm by another two years. The funds granted to all centres duringthe extension period will total more than DM 30 million. In 1994, the Centres ofExcellence pro...

Sick Kids Improves Access To Global Genome Database

...th research facility andone of the world's leading centres for genetics research. Through its Centre forApplied Genomics it offers scientists from HSC and across Canada such servicesas DNA sequencing and synthesis, gene and chromosome mapping, geneidentification, and bioinformatics. The Hospital for Sick Chi...

Money For Old Cable

...d from scrap electric cable in localised recycling centres - and at alarge profit. The process, called Contin... environmental impact meaning that cable recycling centres canbe based at compact light industry plants. This not only requires fewer staffbut can also be loc...

DFG To Set Up 14 New Collaborative Research Centres

...aft (DFG) will set up 14 new collaborativeresearch centres and two new transfer centres. This was decided by the grants committee forthese centres at its summer meeting. From July 1998 onwards, the DFG will fund a total of266 collaborative researc...

Successful Specialist Care For Cystic Fibrosis Patients From Childhood To Adulthood

(Clinical outcome in relation to care in centres specialising in cystic fibrosis: cross sectional s...on resaerch conducted at two adult cystic fibrosis centres in Manchester and Cambridge, the authors conclude that even though previous studies have supported a...

Three-Dimensional Structure Of Human Lung Tryptase Determined, An Enzyme Involved In Allergic Asthma

...other trypsin-like proteinases. The four active centres of the tetramer are directed towards an oval central pore, restricting access for macromolecular substrates and inhibitors. Heparin chains could stabilize the complex by binding to an elongated patch of positively charged residues spannin...

User-Friendly Brace Helps Paraplegics To Walk

...ent's general physical fitness. Mostrehabilitation centres use a so-called 'hip-knee-ankle-foot brace', which supports thepatient's paralysed body from his torso down to his toes. However, many patientsfind this device hardly any help because it is too difficult to use. Walking with such adevice also involve...

Drivers Should Pay More Of Environmental Costs, Report Says

...transit is more accessible to people outside urban centres rather than expanding the existing capacity of downtown transit systems. "The inference here is that there must be reasonable access to public transportation as an alternative if fuller cost pricing of automobile use is to have much impact," the repo...

1 2 3

(Date:3/5/2015)... 2015 Taking center stage at ... Texas April 9-11th is IDRevolution hosted by IDLife ... nutrition. IDLife offers a variety of nutritional ... customized approach to vitamin supplementation is based upon ... free HIPAA compliant online assessment and ends with ...
(Date:3/5/2015)... 2015 Supply & Demand Chain Executive ... “Pros to Know” in the supply chain industry, and ... MEBC’s leadership team were included on this year’s list! ... this award due to their hard work, their commitment ... meeting and resolving client needs and challenges. ...
(Date:3/5/2015)... For PASCHA Chocolate, less is more. ... robust flavor of the cacao bean bursts through without ... free from peanuts, nuts, dairy, soy, eggs, fish, wheat, ... 8th at Expo West., ,    NEW PASCHA Make ... new ground with their New PASCHA Make Me Smile! ...
(Date:3/5/2015)... 2015 Dr. Jonathan Glashow a board ... has been named by Castle Connolly as ... Dr. Glashow has been selected by Castle Connolly Medical ... top specialty care doctors in the tri-state metropolitan New ... program, which carefully screens and selects doctors through a ...
(Date:3/5/2015)... Minneapolis, Minn. (PRWEB) March 05, 2015 ... authority, invites healthcare organizations to participate in its ... includes data from executive and director-level positions, and ... , Last year’s report featured data on ... 28 independent children’s healthcare organizations and 7 subsidiary ...
Breaking Medicine News(10 mins):Health News:IDLife Partners John C. Maxwell and Troy Aikman speaking at IDRevolution in Fort Worth, TX April 9th-11th, 2015 2Health News:MEBC Leaders Awarded Supply Demand Chain Executive Pros to Know Title For 2015 2Health News:PASCHA Allergen Free Organic Chocolate to Appear at Natural Products Expo West March 6-8, 2015 2Health News:Dr. Jonathan Glashow, NYC Orthopedic Surgeon, Named Top Doctor: New York Metro Area 2Health News:Participation Is Now Open For INTEGRATED Healthcare Strategies 2015 Children’s Hospitals Executive Compensation Survey 2
Other Tags
behaviorseducationalbakerfungidonekoreacomparingbogsdisablingminorgainingfaminevargervikpharmacologyhershjones