Tag: "characterize" at biology news

Researchers develop first mouse model of epithelial ovarian cancer

... is a collaborative program designed to derive and characterize mouse models and to generate resources, information and innovative approaches to the application of mouse models in cancer research....

Scientists re-evaluating the meaning of 'desertification,' Duke ecologist says

...is that a single word, desertification, is used to characterize a myriad of issues and in doing so is the root of so many controversies," the Duke biology professor said in an interview. "Those issues range from poverty in rural Africa and shrubs encroaching into grasslands in southern New Mexico to dust storms i...

Pacific Northwest chemist wins national award for studies of biological systems

... national meeting in New Orleans. "We're aiming to characterize as completely as we can these incredibly complex biological systems, to see all of them in all their detail and glory," said Smith, a chemist and Battelle Fellow at the Pacific Northwest National Laboratory. While biological systems being studied tod...

iScope, you scope, we all scope a mouse brain

...use biology sheds light on the complex traits that characterize brain conditions in humans, such as dyslexia, schizophrenia, learning disabilities, and autism. The virtual lab can also facilitate the work of those interested in behavioral research and the brain, Rosen says. In six months, the iScope will advance...

Laser-pulse technique could aid drug design

...eptor and halt the raging "electrical storms" that characterize epilepsy. Also valuable would be a treatment to short-circuit the electro-chemical effects of cocaine, Hess says. "There are more than 5 million cocaine users in the United States alone, at an estimated cost to society of $37 billion annually," he ...

ARC, Varian, Inc. team up to improve water use in pulp and paper mills

...dustry. Our breakthrough has been to recognize and characterize the relationship between particle stickiness and t...nmental effects. Aquantix instruments are used to characterize dissolved and colloidal substances to provide control of the sources and effects of water contaminat...

Cox-2 enzyme plays important role regulating acute pancreatitis and associated lung injury

...t modulate the early intra-acinar cell events that characterize this model of pancreatitis. These include activation of trypsinogen and NF-B, two temporally and mechanistically parallel events that occur within 30 min of the start of cerulein administration. The findings revealed that neither cerulein-induced try...

Blasting antibodies with lasers provides direct way of measuring their flexibilities

...teins? Unfortunately, flexibility is difficult to characterize experimentally, and there has never been a study like this one to carefully examine the details of antibody recognition of antigen at the molecular level, which involves bond vibrations that ever-so-slightly displace atoms a million times every milli...

UT Southwestern researchers say overdoses of acetaminophen cause most cases of acute liver failure

...edicine. "This study is the first to prospectively characterize a large number of patients with acute liver failure," said Dr. William M. Lee, professor of internal medicine at UT Southwestern and the study's principal investigator. "Until recently, only limited data have been available on the causes and outcomes...

Researchers discover gene that controls ability to learn fear

...uthor Vadim Bolshakov at Harvard Medical School to characterize cells in the amygdala that expressed receptors for GRP. Those studies in mouse brain slices revealed that GRP acts in the amygdala by exciting a population of inhibitory interneurons in the lateral nucleus that provide feedback and inhibit the princi...

Checkpoint protein blocks chromosome breaks at fragile sites

... more than 20 years and was the first scientist to characterize the most common sites. He first noticed these sites on all chromosomes during his post-doctoral fellowship at the University of Hawaii, while studying how folic acid deficiency is responsible for the chromosomal break in a rare condition called Frag...

New study pursues the impact of pregnancy on drug efficacy

...e placenta and handles a lot of drugs, as a way to characterize the drugs normally used in pregnant women which can be handled by this transporter," Dr. Ganapathy said of his $1.5 million grant. "These drugs should be flagged saying the efficacy of the drug may be altered during pregnancy because you have this tr...

GSA release 02-55: Dec. Geology & GSA Today media highlights

...4. Today, distinctive suites of animals and plants characterize different parts of the world. On the basis of these distribution patterns Earth is divided into biogeographical regions, or provinces. Provinciality is also known in the geological past, particularly when temperature gradients were steep between the...

Detecting bacteria in space: The good, the bad and the unknown

...infection team, have developed a new technology to characterize unknown bacteria. Its immediate application will be for identifying bacteria in space, but it will eventually aid in diagnosing medical conditions and detecting biological hazards on Earth. "Understanding the bacterial environment is important for a...

School of public health launches CDC Center for Excellence in Environmental Public Health Tracking

...rings together environmental protection efforts to characterize and control sources with public health surveillance to understand adverse exposures and health effects," explained Dr. Burke. "This offers a chance to begin piecing together a very complex puzzle, and develop a sounder public health basis for nationa...

Purdue scientists lead $5.9 million plant study to improve products

...or satellite imaging of the Earth, to identify and characterize mutant genes that affect plant cell wall architecture. Another research team member, Maureen McCann of the John Innes Center in Great Britain, hatched the idea of using infrared spectroscopy to screen for mutants. "Often it's difficult to know wheth...

Scientists produce the script for life

...the types and amounts of the various proteins that characterize a particular cell type, be it a skin cell or a blood cell? The genome also specifies the screenplay that coordinates the production of these proteins, and, in turn, how living cells develop and respond to changes in environment. Special proteins call...

New guide helps researchers mine genome data

...ffered in that spirit of altruism that has come to characterize the public world of genomics." In the 79-page guide, the NHGRI team focuses mainly on the three major genome portals that contain freely available data produced by the International Human Genome Sequencing Consortium and other systematic sequencing...

Allergic to your DNA?

... cancer prevention. The morphological changes that characterize apoptosis include nuclear DNA fragmentation and digestion although research has shown that cells can undergo apoptosis without DNA degradation. Dr. Shigekazu Nagata and colleagues at Osaka University in Japan set out to determine the biological sign...

From moon rocks to space food: UH research spans 40 years

...Shield was the first experiment to comprehensively characterize the wake vacuum of a spacecraft in low earth orbit. Materials grown in orbit have led to terrestrial applications such as bionic eyes, high-efficiency lasers and new sensor technology. Since 1992, the UH Cullen College of Engineering has administere...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... New York, New York (PRWEB) May 22, 2013 ... for the nation’s first trial involving a da Vinci ... in the case, the family of a man who allegedly ... is seeking more than $8 million in damages from Intuitive ... watered down its physician training program for the da Vinci ...
(Date:5/22/2013)... IL (PRWEB) May 22, 2013 Nearly ... Veterans’ Appeals (BVA) in fiscal year 2012, with even ... themselves waiting longer for a decision as the agency ... Allsup, which provides veterans disability appeal services. ... of Veterans Affairs. , Although the BVA received 49,611 ...
(Date:5/22/2013)... is a gender gap when it comes to behavior ... does not appear to exist in children in Asia. ... of self-regulation than boys. Self-regulation is defined as children,s ... and persist on a task. It has been linked ... by Oregon State University researchers. , In three ...
(Date:5/22/2013)... 2013 Successful Therapy for Parents ... Psychotherapy in the Silver Lake community of Los ... as progression to existing Parents and Couples counseling ... parenting therapy has always been suggested, but now ... now specializes in all aspects of relationships ...
(Date:5/22/2013)... 2013 Diversity Focus and Handicap This ... The performance promotes awareness that physical disabilities do not ... performance will be held Friday, June 14th at 7:30 ... Tickets for Handicap This! can be purchased at ... the level to which their mind is handicap accessible. ...
Breaking Medicine News(10 mins):Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 2Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 3Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 4Health News:Veterans Disability Appeals See Fewer Decisions in FY2012, Reports Allsup 2Health News:'Boys will be boys' in US, but not in Asia 2Health News:'Boys will be boys' in US, but not in Asia 3Health News:Patricia O’Laughlin Psychotherapy of Los Angeles Now Seeing Adults, Teens and Young Children 2Health News:Handicap This! Comes to Marion, Iowa 2
Other Tags
penniesswallowgabapentinrelievedlocationtanningguardiansleuthresponsibilitywalkspercentagerankingsavoidscoolingminiinvestigated