Tag: "chimp" at biology news

One Chimp Can Perceive States Of Awareness In Others

...the hidden predator. "This suggests that one chimp does recognize the different knowledgestate in the...variables that exist in the wild and tested if one chimp wouldwarn another specific chimp of a threat. "They responded dramatically when a threat was p...

Monkeys Have Numerical Abilities, Two Columbia Psychologists Report

... However, Prof. Terrace was notconvinced that the chimp had demonstrated the ability to create uniquesentences, the hallmark of language. After analyzing more than 20,000 differentcombinations of signs produced by the animal, Prof. terrace concluded that Nimsigned mainly to obtain particular rewards and ...

Resolving Conflicts -- What We Can Learn From The Apes

...onnection to its evolutionary past. Havingstudied chimp societies for many years and authoring numerous scientificpapers and books, de Waal's research of chimpanzees and other primatesillustrates how reconciliation and consolation serve to repair socialrelationships within the complex social system of pri...

Should Great Apes Be Given Legal Rights?

...rned individuals to step inwhenever they believe a chimp or other great ape is being mistreated, much as wealready use the courts to protect children. But while the campaign has many supporters, the possibility that greatapes may soon have legal standing in New Zealand is making some biomedicalrese...

Protestors Are Up In Arms Over Experiments That Give Chimps AIDS

... with similar respect. "You can compare a chimp to a mildly retarded child. Just because it'smildl...nta reported a single case of HIV causing AIDS ina chimp (Journal of Virology, vol 71, p 4086). Since then, the virus responsiblehas been deliberately passed...

Immune Response To Hepatitis B Spares Liver Cells

...animals throughout the course ofthe infection. The chimp HBV infections ran their course and the animals recovered withoutfurther complications. Most HBV infections in adult humans are similarlyuncomplicated. However, between 5 and 10 percent of the estimated 320,000 newHBV infections in the United State...

Chimpanzee subspecies are genetically mixed and more diverse than humans, according to research in 5 November 1999 Science

...em to be derived from them. Thus, if you like, the chimp 'Eve' of this sequence lived in central Africa," he said. But Pbo and his colleagues acknowledged that mitochondrial DNA studies, which show the most diversity in the western population, clash with this version of events. The research team encountere...

Genes pertaining to 'maleness' evolve more rapidly than their non-sexual counterparts

...tinguishable from one another. That the human and chimp sperm genes were so radically different suggests e...ternal sperm competition, puts intense pressure on chimp male genes to evolve rapidly. Conversely, gorillas employ a harem system where one high-ranking m...

We are family: the imperative for a chimpanzee genome project

...ad, the virus lives in peaceful symbiosis with the chimp immune system. Less commonly known is that chimps...ki, we have a biomedical imperative to embark on a chimp sequencing project. As an added incentive, sequencing the chimp genome should provide us with intri...

Halfway human

... you take a small female gorilla skull and a large chimp skull, they're very hard to tell apart." But Wolpoff's recent study did look for proof of interbreeding in bones. He used a checklist of diagnostic features to rate a group of modern and ancient skulls from Europe and Australia as well as archaic...

Men regain evolutionary drivers seat

...late in the genome of a species whether its bird, chimp or human."...

Discovery Channel special watches OSU chimps learn to read

... accomplishment -- giving a chimp a dozen-word vocabulary. But it is really a major step forward in a 20-year study of how these great apes learn, ...

Understanding our ape 'cousins:' chimpanzee genetics may shed light on human diseases

...e expression in humans were more like those in the chimp than in the macaque. Differences in gene expression from the macaque pattern appear to have accumulated at roughly the same rate in humans and chimpanzees, which might be expected given their close evolutionary ties. But the brain tissue told a diffe...

NHGRI prioritizes model organisms for sequencing

...tudying the two sequences. Comparing the human and chimp genomes, in particular, may provide insights into human diseases because there are a number of medical conditions that affect humans but not chimpanzees. Chimpanzees themselves cannot -- and will not -- be used in any experimental studies. A working ...

Endangered chimpanzees focus of urgent action

...conference at the Golf Hotel, Sept 12 and 13, with chimp conservation experts from Africa, the United State...ically for biomedical research. Bush meat trade in chimp meat is a serious problem also because of severe health risks posed to humans who eat chimpanzee mea...

A new way to compare human and other primate genomes

...he argues, comparing the human genome to that of a chimp or a baboon, is like comparing a sedan to a statio..., however, comparing the human genome to that of a chimp or baboon has been a problem since both genomes are so much alike. As Boffelli, who works with Rubin...

Rumors of male chromosomes demise greatly exaggerated, study finds

...findings, involving observations in both human and chimp male chromosomes, could explain how the Y repairs ...ue not only in a human Y chromosome, but also in a chimp Y. "When we look at the human Y, compared with the chimp Y," Page said, "what we can infer is that d...

Chimp genome assembled

...ich is based on four-fold sequence coverage of the chimp genome, into the NIH-run, public database, GenBank...litate biomedical studies comparing regions of the chimp genome with similar regions of the human genome, the researchers also have aligned the draft version...

Lifestyle accounts for difference in chimp, human genome

...cause of the need to be sure that the right human, chimp and mouse genes were aligned. According to Clark, all mammals have an extensive repertoire of olfactory receptors, genes that allow specific recognition of the smell of different substances. "The signature of positive selection is very strong in ...

Chimp vs. human DNA: what's in the 1% difference

...cause of the need to be sure that the right human, chimp and mouse genes were aligned. According to Clark, all mammals have an extensive repertoire of olfactory receptors, genes that allow specific recognition of the smell of different substances. "The signature of positive selection is very strong in ...

1 2

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid