Tag: "closely" at biology news

MSU group reviews Berkeley venture into brave new science funding world

...worth. That is the greatest legacy of the nation's closely followed and much-debated marriage between University of California-Berkeley and the Swiss pharmaceutical and agrochemical company Novartis. Today, a group of social and natural scientists at Michigan State University released a report commissioned ...

Study finds anti-HIV protein evolved millions of years before the emergence of AIDS

...milar analysis of other mutation-inducing proteins closely related to Apobec3G and found that some of them also show signs of evolutionary pressure. These too may have arisen to defend the host genome against mobile genetic elements and may now play a role in defending against as-yet-unknown viruses. Malik s...

Save the rainforest - eat a tree

...ay soil, while the other species in the pair was a closely related tree that normally lives on white sand soil. The researchers built 22 cage-like enclosures made of nylon netting to keep insects out. Each cage measured about 10 feet wide, 10 feet deep and 6.5 feet tall. They also built another 22 n...

Whale carcass yields bone-devouring worms

...searchers determined that the whale-fall worms are closely related to the large tube worms found at deep-sea hydrothermal vents and cold seeps. Both types of worms obtain nutrition with the help of symbiotic bacteria. Further analysis of the DNA data yielded some surprising results. For example, aft...

Insecticide resistance: A constraint on evolutionary change

... appear in Ae. aegypti populations. Looking more closely at the Ae. aegypti gene sequence for AchE1 revealed the answer. The researchers found that in this species, the three-letter DNA code at glycine position 119 is different from that found in the other mosquitoes studied thus far. The difference is "...

Location of potential familial lung cancer gene discovered

..." The next goal for these researchers is to more closely examine this region of chromosome 6 with the aim of locating the exact gene or genes that cause lung cancer susceptibility. The identified region corresponds to roughly a 20 million base pair segment on the long arm of chromosome 6. The region cont...

Geologists discover water cuts through rock at surprising speed

...The project is unique because it used many samples closely spaced to understand the spatial patterning of how and when the rivers cut into rock, according to Paul Bierman, professor of geology at the University of Vermont and co-author of the Science paper. "Without such detail, we never would have been ab...

Mapping the evolution of a virus

...map that shows the virus evolved as a series of 11 closely related virus clusters as it has sought to elude human immunity over the decades. The mapping method will allow researchers involved in vaccine development and viral surveillance programs for influenza, and potentially for other pathogens such as Hep...

Songbirds escaped from Australasia, conquered rest of world

...NA sequences of two genes in all but one family (a closely related group, such as "crows and jays" or "warblers") of passerine birds, Barker and his colleagues made a startling discovery. "It was thought that the Passerida arose in Eurasia about 40 million years ago," said Barker. "But we found that these...

Genetic model for devastating form of paraplegia suggests new treatments

...ally growing and shrinking, and their stability is closely regulated by a number of associated proteins. In nerve cells, microtubules carry cellular components to distant regions of the cell, regulate the growth of cellular branches and provide a substrate for important protein interactions. All of these fun...

New model explains why costly insect 'outbreaks' hard to predict

...disease among insect populations. These models can closely approximate the average length of time between outbreaks, but they fail to explain the relatively irregular timing with which outbreaks tend to occur. The other camp has focused on the role of "generalist" predators, such as spiders and birds. ...

Scientists find 75 percent of red snapper sold in stores is really some other species

... names of more expensive ones. Substitutions among closely related fish are difficult to detect, because most distinguishing features are lost during processing." The team conducted molecular analyses of 22 fish bought from nine vendors in Delaware, Florida, Illinois, Massachusetts, New York, North Carolina...

New pulmonary hypertension guideline challenges use of common medication

...at risk for developing PAH, allowing clinicians to closely monitor patients and begin treatment at the first sign of the disease." The evidence-based guideline is based on a structured review of all available guidelines and published research related to PAH. The guideline provides specific recommendations f...

Study reveals evolution on the (butterfly) wing

...temporal pattern formation process from a group of closely related organisms," said Reed. "And to have all of these temporal time points for multiple genes from so many species allows a unique perspective onto the issue of how changes in temporal gene regulation can underlie the evolution of morphology." T...

Chipmunks descended from ancestors that survived last ice age, scientists say

...that while chipmunks in Illinois and Wisconsin are closely related, they are distantly related to chipmunks in Indiana and Michigan," he said. "There really is no clear geographical barrier at present that should lead to their isolation, so chipmunk history may be responsible. From our data, this history a...

Lack of immune system protein prevents lupus-like condition in mice

...ve the immune system producing antibodies that are closely customized to attack targets they shouldn't be attacking," he explains. "So SAP may be a contributor to these conditions as well."...

University of Chicago scientists pinpoint cellular cause of SIDS

...ng with six of his investigators, are looking more closely at the effects of serotonin on sodium-driven pacemaker neurons. Their work should provide more insight on the body's gasping mechanism, as well as SIDS....

Only 21 states offer newborn screening tests recommended by March of Dimes

...Our chapter staff and volunteers have been working closely with governors, state legislators, and health departments to increase access to these important tests," Dr. Howse says. "I'm encouraged to report today that since this time last year, the number of states that test for the nine core metabolic disord...

Herpes tool allows researchers to customize Alzheimer's vaccine

... from the National Institutes of Health to study a closely related topic, the role of inflammation in the disease. Understanding how inflammation contributes to Alzheimer's will help Bowers and others create a vaccine best suited to treat or prevent it. Central to their efforts is the herpes virus, best kno...

Hopkins to found first center for comprehensive study of epigenetics

...areers in genome sciences," says Feinberg. Others closely involved with the center's work are Karl Broman and Margaret Fallin, Johns Hopkins Bloomberg School of Public Health; James Potash, Hengmi Cui, Patrick Onyango, J. Raymond DePaulo, Hans Bjornsson, David Nichols and Jef Boeke of the Johns Hopkins Scho...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... Family Magazine of Washington DC was awarded the "Best ... Inc. in the category of Summer Camps in DC ... the areas best in the ultimate guide on parenting, kids ... Brenda Hyde, a mother of four and publisher of Family ... vast resources available to them in the DC Metro area. ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 During Better ... loss should consider the legal protections they have, including ... problems arise with their child’s treatment or hearing aid ... Since 1927, the American Speech-Language-Hearing Association has used the ... and to promote treatment, such as cochlear implants, which ...
(Date:5/18/2013)... 18, 2013 Simple changes in a ... snacks and drinking more water can lead to substantial ... a healthier lifestyle overall. Diet Doc understands ... weight loss can be difficult and often requires the ... plans to help patients get over initial weight loss ...
(Date:5/18/2013)... 2013 6Webs.com is the leader in ... reviews and comprehensive comparisons make 6Webs.com the useful resource ... 6Webs.com just recently finished conducting their assessments of the ... Smythe from 6Webs.com reports, "There has been an increase ... ease of use, expandability and mobility. Combine these features ...
(Date:5/18/2013)... Show And Go Training, the culmination of ... systems that is all about is getting results in the ... http://ShowAndGoTrainingReview.com ’s Stan Stevenson, prompting an investigative review. ... “four phase system” designed to make you faster, stronger, fitter ... working out in the gym. The training manual and exercise ...
Breaking Medicine News(10 mins):Health News:Summer Camps in DC "Best of the Best" Awarded to Family Magazine of Washington DC for Excellence by Follow Media Consulting, Inc. 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 2Health News:Schachter, Hendy & Johnson PSC Lawyer Says Cochlear Implant Victims Should Know Their Legal Rights 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Best Wireless Home Security System Companies Released by 6Webs.com 2Health News:Show And Go Training: Review Examining Eric Cressy's Workout Program Revealed 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade