Tag: "closer" at biology news

Cornell Researchers Precisely Date Wood From Ancient Tomb In Turkey

...eir latest findings have brought them considerably closer and will enhance their understanding of the relationship between pivotal cultural events of the past and present. "Often the different dating systems which have been used in interpreting the history and archaeology of the Near East have had profound ...

Honeybees In The Wild Nearly Gone In North America

...onies in the United States,"Tew said. "What's much closer to extinction, however, isthe unmanaged population of honeybees." The European honeybee, which was brought to the United Statesin the 1600s, is the country's most important bee for crop pollinationand honey production, Tew said. According to the Ohio...

Core Spins Faster Than Earth, Scientists Find

...rth-southpathway moved faster than those traveling closer to the equator.The scientists theorized that the enormous pressure in the Earth'score, which is millions of times higher at the inner core surfacethan the atmospheric pressure at the Earth's surface, has alignediron atoms in a distinctive crystalline...

Northwestern Scientists Discover How Herpes Simplex Virus Infects Cells

...s penetrates lymphocytestakes researchers one step closer to understanding how recurrent herpeticdisease can occur in persons with normal immune systems and will lead todevelopment of new classes of antiviral drugs," said Patricia G. Spear, whoheads the laboratory at Northwestern where the discovery was mad...

Impact of Meteorites, Drop in Sea Level Caused Mass Extinctions 65 Million Years Ago

...t of all species worldwide 65 million years ago is closer to a resolution, with new research by scientists from UCLA and the University of Washington. The research was funded by the National Science Foundation (NSF). A cover story in the November 22 issue of the journal Science reports the res...

Plants Have Future As Environmental Clean-Up Agents

...pes ofchemicals, while other chemicals are brought closer to the surface,which can hasten their degradation because oxygen is present. "In some cases, we have actually seen 10 pounds per acre a dayremoved," Davis said. "It really depends on what's present there." In either case, using plant-based bioremed...

Two Parasitic Wasps Show Promise For Controlling Pest Flies

...ifornia and Northeast dairies, they may be worth a closer look asa biological control in Illinois, said U. of I. agricultural entomologistRichard Weinzierl. The findings were published in the April issue of Environmental Entomology. Working with Weinzierl on the project, which was funded by the USDA andthe...

One Chimp Can Perceive States Of Awareness In Others

...henthe argument that in some ways, chimpanzees are closer to humans than theyare to other primates. The studies were presented Aug. 16 in Chicago at the annual meetingof the American Psychological Association. Sally Boysen, associate professor of psychology at Ohio State and directorof the project, sa...

Fossils Show British Columbia Was Once 2,000 Miles South

...ase, the sedimentary rocks showed a magnetic field closer tohorizontal than would be expected for northerly latitudes. Since there was noevidence of heating, and remagnetization, the conclusion was that the rockswere formed far to the south 70 to 80 million years ago, based on the evidenceof fossil dating....

Further Proof That An Altered Rb-2/p130 Gene Leads To Lung Cancer

...er is. “Now a tumor grading test is much closer to reality,” said Giordano, who is also president of the Sbarro Institute for Cancer Research and Molecular Medicine, which is affiliated with the college. Of particular importance, he noted, was the strong relationship between...

New Form Of Gene Therapy Holds Promise For The Future

... Southwestern Medical Center atDallas are one step closer to producing a "drug" that is internally regulatedand activated only when needed. They have developed a system in mice in which the level of a geneticallyengineered protein responds to inflammatory signals produced by the micethemselves. Thi...

Triglyceride Blood Levels Predict Heart Attack

DALLAS, Oct. 21 -- Physicians may need to pay closer attention to anindividual's triglyerceride levels, according to researchers who say the bloodfat is a "strong gauge" of a person's risk of heart attack. The findings appearin today's Circulation, a journal of the American Heart Association. ...

Biogenic Emissions Higher Than Expected Over African Savanna

...heric ozone shields us from ultraviolet radiation, closer to the earth this molecule damages forests and crops; destroys nylon, rubber, and other materials; and injures or kills living tissue. Ozone is a particular threat to people who work or exercise outdoors or who suffer from respiratory problems. ...

Genetic Risk Factors For Anorexia Nervosa Sought

...f thegenome, prompting the scientists to perform a closer analysis of that segment ofDNA. According to Berrettini, anorexia nervosa is defined as an eatingdisorder characterized by a refusal to ingest sufficient quantities of food tomaintain 85 percent or more of normal body weight, an irrational...

Scientists Work To Restore Native Fish And Habitat To Great Lakes

...e fish need to survive and thrive. We will take a closer look at nearshore fishery habitats and examine the impact of exotic species. This information will be useful to management agencies to direct habitat and fish population restoration," said Dr. Smith. The Fish & Wildlife Service will focus on select...

New Gene Alteration Find Points To Aggressive Leukemia Treatment

...ad normal chromosomes. In 11 of these patients, a closer examinationshowed that a short segment of the ALL1 gene had been duplicated and splicedback into the gene. In every case with these patients, their prognosiswas more serious than that of patients lacking this defect. Patients with the defect r...

UF Researchers: Development Promotes Disease Among Gopher Tortoises

...ida is forcing the threatened gopher tortoise into closer and closer quarters, increasing the likelihood of them spreading a disease that could help speed their demise, ...

DNA Used To Create Self Assembling Conducting Wire: Breakthrough Will Lead To Next Leap In Emerging Nanoelectronics

...slaid end to end.) By packing many more components closer together, scientistscould produce computer chips that are much faster than today's, and far moresophisticated. Scientists have already used DNA to assemble minute nanoparticles ofsemiconductors and other electronic material into crystal-like...

Researcher Identifies Two New Violet Species In Central America

... and were classified as existing species. But upon closer inspection ofthe specimens, Ballard determined the two violets were new species. "These species have been overlooked for years and had beenmisclassified," Ballard said. "But after I studied them for awhile, I knew theywere new species." ...

Pet-Owning Couples Are Closer, Interact More Than Pet-Less Couples, UB Study Shows

...R BEACH, Fla. -- Couples who own cats or dogs have closer relationships, are more satisfied in marriage and respond better to stress than couples who do not, a new University at Buffalo study has shown. Measures of heart rate and blood pressure taken during a situation known to be a source of conflict ...

1 2 3 4 5 6 7 8 9 10

(Date:10/31/2014)... (PRWEB) October 31, 2014 Springboard ... for its small scale BioPro™ biodiesel processors, announced ... will further improve the performance and efficiency of ... GL95/MC12/BD380 trio will recover more than ... in with the glycerin by-product produced while making ...
(Date:10/31/2014)... (PRWEB) October 31, 2014 The Memory Healer ... created by Alexander Lynch, whose father suffered from Alzheimer's disease. ... dramatic moment, caused by his father's disease. His father pointed ... was the crucial moment when the author of this method ... dad. , The Memory Healer program is based on ...
(Date:10/31/2014)... Missouri (PRWEB) October 31, 2014 At ... country about families narrowly escaping carbon monoxide poisoning in ... looms just weeks away, one family-owned, Missouri-based heating and ... approach to making sure families start the home heating ... safe and secure. , Beginning Nov. 1, 2014, ...
(Date:10/31/2014)... 2014 (HealthDay News) -- Surgery for low back pain ... the United States you live, a new report says. ... back pain at some point in their lives, and ... care for a spine problem," co-author Brook Martin, of ... said in a college news release. In spinal ...
(Date:10/31/2014)... – New research suggests that insomnia is a major ... other unintentional fatal injuries. The results underscore the importance ... National Healthy Sleep Awareness Project. , Results show that ... dose-dependent manner with the number of insomnia symptoms present. ... times more likely to die from a fatal injury ...
Breaking Medicine News(10 mins):Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 2Health News:Springboard Biodiesel Announces Release of New and Unique Methanol Recovery and Glycerin Treatment Equipment 3Health News:"Memory Healer" Review Reveals a New Natural Remedy Guide for Managing Memory Loss 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 2Health News:Many Homeowners Missing Key Safety Risks with Home Heating;Missouri-based Company E and Q Announces New Safety Check 3Health News:Spinal Surgery Varies by Region in U.S.: Study 2Health News:Insomnia increases risk of motor vehicle deaths, other fatal injuries 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting