The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "clues" at biology news

Researchers Pinpoint Site For Petit Mal Seizures In Brain

...versity Medical Center reported Monday finding new clues about the precise location in the brain that causes the common childhood form of epilepsy. The findings may lead to more specific drugs for the disorder with fewer side effects, said Dr. David Hosford, assistant professor of neurology at Duke and the...

Dating A Caveman

...currently engaged in numerous studies using subtle clues in ocean or lake sediments to study the past climate on Earth. One such study, for example, uses ratios of oxygen isotopes found in sediments from California's Mono Lake to reconstruct detailed climate fluctuations in the area since 10,000 years ago,...

Protein Glitch May Be Early Problem In Inherited Alzheimer's

Johns Hopkins scientists have assembled the first clues to the behavior of presenilin, a protein linked to an inherited form of Alzheimer's disease. In a report published in the July issue of Neuron, they show that presenilin normally cleaves in two and that a disease-causing mutation in presenilin can ...

New Ultrasensitive Technique For Accurately Characterizing Biomolecules Is Developed By Cornell Chemists

...le -- do these contain new molecular components as clues to their formation? You could get a better idea of how a cell system works or how a single signal nerve functions. You can use it with RNA and DNA, as well as proteins."...

Duke Ecologist Says Logging Is Creating 'Mahogany Deserts'

...ad avidlywhile at Grinnell, she collected multiple clues to unravel the mystery. Hurricanes periodically blow through Yucatán forests, she said. "Theyknock down some trees and branches, but most of the trees survive."However, the fallen debris provides ample fuel "that ignites in thenext dry season...

Medicinal Leech May Offer Clues To Neural Regeneration

...ctors to bleed patients, now is being used to draw clues on how a common protein may help promote neural re... nerves regenerate in a simple system, we may find clues to facilitate regeneration in vertebrates." When activated, NOS produces nitric oxide, a gas that in...

Methane Deep In Ocean Crust Could Feed Chemical-Hungry Microorganisms

..., Kelley studies minuscule amounts of seawater for clues about what could be a major source of methane and hydrocarbons. She has access to samples of a drill core from the Southwest Indian Ridge near Madagascar. It's there that a portion of layer three has been thrust up to where humans can drill it for ...

A Phoenix From A Ring Of Fire Is A Pattern For The Recovery Of Mount St. Helens

A lush volcanic island in Indonesia provides clues about Mount St. Helens' recovery from its moon-like state On August 27, 1883, the volcano Krakatau in the Dutch East Indies erupted with the force of more than 10,000 Hiroshima-type hydrogen bombs, killing an estimated 30,000 people and le...

Stuttering Appears To Have Strong Link To Family Genes, Researchers Say

...are "only the tip of the iceberg," hesaid. Finding clues as to which kids will persist -- the aim of the overallproject -- will help to target them for early intervention. The geneticlink "is so far the single strongest, consistent, reliable predictorthat we have," Yairi said....

New Evidence For Corn's Ancestry Could Lead To Insect And Drought Resistant Crops

...hat meant her pottery studies could give him vital clues about how domesticatedcorn looked many centuries before the Spanish conquest. So her research trips to Mexico and Peru aided Mangelsdorf's continuingwork. In turn, Mangelsdorf's passion quickly rubbed off on her. Eubanksbegan studying biology and pe...

Where Fossils Fear To Tread: Scientists Follow Genes To An Ancient Ancestor

...t there are virtually no fossils or other physical clues to what the Earth's earliest animals were like. But Carroll and others are now finding powerful evidence that an ancient common ancestor - a worm-like animal from which most of world's animals subsequently derived - invented a set of body-bu...

MGH-Led Team Finds Gene For Crippling Neurologic Disorder

... more than 15 years of work and contains important clues that could lead to better understanding of the disease and possible preventive treatments. There are many types of dystonia, a term that generally refers to sustained,involuntary muscle contractions that can twist and contort parts of the body. Earl...

Insects Provide Clues About Bodies Underwater

...d lakes in local forests next month hold important clues about deaths thatoccur in freshwater. For the past year, the Simon Fraser University graduate student in pestmanagement has made routine visits to the clothed and submerged 'bodies' tostudy the life cycles of insects that colonize on them - everythin...

NIDR Supports Total Genome Studies Of Major Oral Pathogens

...ilarities to well-characterized genes will provide clues as to the functionof the Candida genes. The project has already identified over 100 new Candida genes and willeventually produce at least partial sequence data for approximately 95 percentof the total number of genes. Genes that appear to have inter...

Colorado State Scientists Tackle Genetic Makeup Of Obscure Bacteria

...erent regions. Wethink this could provide some key clues as to where to look to find the genesthat produce the bacteria that cause disease and the bacteria that don't." Once these genes have been identified, there is a possibility thattechniques could be used to transfer genes that make the bacteri...

Skull Of Refrigerator-Size Ancient Armadillo Finds A Home At UF

...able to see on the teeth may give us some valuable clues about these creatures' diet. We really don't know ...dicate the specimen was a juvenile, which may give clues about the armadillo's growth sequence, McCarty said. "We don't know much about juveniles or how they...

Mysterious Wildlife Disease

...nter are under way, and scientists are hoping that clues from the new locations will help to reveal the cause of the disease. Wildlife managers throughout the United States are being asked to observe coot populations for disoriented or uncoordinated behavior such as erratic flying or impaired abi...

Widespread Genus Of Monkeys Gives Up Genealogical Secrets To Columbia Researchers

...different periods in history will give researchers clues to whatfactors influenced that distribution, and will be of most immediate use inhelping decipher the movements of two other widespread primate groups, the leafmonkeys and the gibbons, the researchers said. "With each successive genus that is ...

Genetic "Short Circuit" Leads To Cleft Palate

...Melnick feel that the mouse model will provide the clues that eventually unravel the mysteries of cleft palate. At present, he thinks that it is still premature to pinpoint the underlying causes of cleft palate from human studies. "It is apparent from studying complex disorders like cleft palate, that si...

Vertex Pharmaceuticals Researchers Report Three-Dimensional Structure Of Hepatitis C Helicase Enzyme; Report In Structure

...f the NS3 helicase. The structure yields important clues regarding the mechanism by which helicaseenzymes unravel double-stranded nucleic acid helices. "The atomic structure of the HCV helicase enzyme shows several unique featuresthat we believe will provide opportunities to accelerate our ongoing efforts ...

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)...IS, Dec. 2 While many Am...mic challenges including rising costs of,basic ne...ress Scripts,(Nasdaq: ESRX ) has expanded Rx Ou...rescription medicines. , (Logo: http://ww...LOGO ) , Lower-income consumers can now rec...
(Date:12/1/2008)...GO New research reveals that computed tomography ...py, has the potential to screen for two diseases a...which commonly affect adults over age 50. Results ... meeting of the Radiological Society of North Amer... to screening for colorectal cancer, we were able ...
(Date:12/1/2008)...k Warren Presents Award, Engages with President on...Home and Abroad During Saddleback Civil Forum on G...wire/ -- President George W. Bush was honored on t...the "International Medal of PEACE" given by Dr. Ri...during the Saddleback Civil Forum on Global Health...
(Date:12/1/2008)...lls shut down and stop dividing when their DNA is ..., so as to prevent damaged DNA from leading to unr...er, a new study, published in this week,s issue of...hut down they also spew proteins into their surrou...ts up conditions that support the development of a...
Breaking Medicine News(10 mins):Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 2Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 3Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 4Health News:CT colonography offers 1-stop screening for cancer and osteoporosis 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 3Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 4Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 5Health News:Escape cancer, but age sooner? The dark side of the tumor suppressing process 2
Other Tagsrejecting 2simulates 2meal 2meal 3meal 4winner 2winner 3pair 2pair 3pair 4cheaper 2cheaper 3continue 2continue 3continue 4continue 5continue 6continue 7continue 8continue 9continue 10
maxinerejectingsimulatessfusodroskijoemealdemystifiessilverwickednesswinnerpaircheapercontinuetestifiessolitary