Tag: "clues" at biology news

Researchers find new clues to nerve cell development

...erve cells that extend out to detect environmental clues and help direct axons to their proper destinations. Until now, scientists didn't know what kind of signals filopodia sent back to the cell tip, called a growth cone, or how they controlled movement. University of Wisconsin Medical School researchers...

UC Davis science, engineering and technology newstips -- March

...ossible explanations are that the birds use visual clues that tell them the flower is empty, or that they remember robbed flowers from previous visits, she said. To block visual clues, she painted over the flower bases to disguise bee holes and nectar content. Despite this, the birds still went for the fu...

Scientists, ships, aircraft to profile Asian pollution and dust

...ozone. The three "identifiers"will give scientists clues to the age and history of the various airmasses. "We're also suspecting that carbon monoxide and mercuryemissions are going to correlate pretty well," she says. ACE-Asia is the third in the ACE series of experiments, each oneramping up the targeted p...

Genes don`t control human behavior, evolutionist says

...estingly, the business community is providing some clues through the relatively new science of marketing. Scientists should not ignore the findings of marketing simply because they may disapprove of some of the uses the business community puts them to." According to Ehrlich, "We must strive to evolve a ne...

Major fossil find reveals Asian origins of salamanders

...in. "The exquisite condition of the fossils offers clues to evolutionary strategies--larval details such as gills in adult animals, for example." Salamanders are living fossils--they have retained the same body plan for millions of years. "Whether you look at a salamander you find under a rock in the...

Scientists probing the origins of life develop method of making novel proteins using a 21st amino acid

...technology industry while providing some important clues to answering the question: "How did life begin?" The research provides significant evidence for the existence of the so-called RNA world, believed to be the evolutionary stage that predates present biological systems. It was published today (April...

Virus studies reunite two families of major insect-borne viruses

...sequences that make up the genomes, thus providing clues about the viruses' evolution," he says, noting that this concept was developed 25 years ago by Purdue researcher Michael Rossmann. X-ray crystallography is a technique often used to study structures such as proteins and viruses in atomic detail. B...

Nature reserves aren't protecting pandas, study shows

...ly examined human population dynamics for further clues into why the rate of habitat destruction increased dramatically inside the reserve after the reserve was established. "One thing ignored in traditional research is the importance in changing population structure would have on biodiversity," Liu s...

Wood preservation: stopping termite destruction and making safer wood preservatives

...one generation of shipworm to the next may provide clues to slowing the reproduction of shipworms, thereby delaying or preventing damage to wood. (The paper on this research, CELL 88, will be presented at 9:30 a.m., Wednesday, April 4, in the San Diego Convention Center, Room 11A.) Exploring the ...

Sea grant researchers developing new stress test for fish

... at risk for becoming sick, but before any visible clues are present. "These HLPs were found in the spleen, skin, and gills and are probably in other tissues of catfish," said Ed Noga, professor at North Carolina State University College of Veterinary Medicine. "So these HLPs appear to be everywhere. Thi...

Collapse of simple life forms linked to mass extinction 200 million years ago

... the Queen Charlottes this summer to look for more clues in the Triassic-Jurassic extinction, including potential causes....

University of Pittsburgh researchers identify subtype of cell that promotes organ transplant acceptance

... "We'd like to identify the cellular and molecular clues so that assays, or very simple laboratory tests, can be developed that would be predictive of tolerance," added Dr. Zeevi, professor of pathology and surgery at Pitt's School of Medicine and the Starzl Transplant Institute....

Brain gene implicated in autism

...e associated with the chromosome 7q area. Among clues being followed up: a gene named "frizzled" that codes for a receptor for the secreted WNT proteins "is right at our linkage signal," noted Wassink. His and other groups are also looking for mutations in other genes in WNT pathways that might be invo...

Researchers find first gene that increases risk of Crohn's disease

...Crohn's disease, note the authors. "By providing clues to disease pathways," said Cho, "and directing us to related proteins, the identification of Nod2 mutations may accelerate the process of finding subsequent Crohn's disease-associated mutations. If we can figure out how these genes interact with eac...

Dopamine-dampening gene linked to prefrontal inefficiency, schizophrenia

... share with their well siblings, hoping to turn up clues to susceptibility genes. Their brain imaging studies had revealed that both well siblings and patients falter on tasks of working memory and show abnormal activation of the prefrontal cortex, which is required for such "executive" functions. Studies...

UCSD biologists identify 548 genes in the fruit fly likely to play a role in human genetic diseases

...athways, the fly studies should provide invaluable clues to narrow down the search for genes causing similar disease conditions such as the many inherited forms of Alzheimer's disease. How many human diseases could be studied in fruit flies? Of the 548 genes identified in the analysis, Bier suspects ...

Biting may drive division of labor among social wasp workers

...ts like O'Donnell study social insects looking for clues about how social behavior evolved and how it is maintained since there are elements that are shared among all social animals. Social aggression is one such characteristic that is almost universal among animal groups from insects to primates....

UCSD researchers decipher molecular "code" capable of controlling plant water loss during droughts

... resistance to drought conditions." "Its given us clues of where to look for the genes and proteins that control the closure of stomata," says Allen. "These are some of the unknown pieces of the puzzle."...

Never-before-seen look deep inside cancerous tumors

...us mass, and they hope this information will offer clues to the mechanism of tumor angiogenesis. "Theres a dance between the cancer cells and the host cells. Well now be able to see how that occurs," says Jain. The scientists were also able to use their technique to track individual cell population...

SAGE pronouncements on long life

... worm Caenorhabditis elegans. Their results yield clues to the distinctive biology of long-lived worms. The researchers focused on a form of C. elegans called the dauer, which is non-reproductive, long-lived, and resistant to stress. To identify genes particularly active in the dauer, the researchers use...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument