Tag: "cod" at biology news

Environmental jigsaw pieces fall into place

...an be measured in terms of the number of catchesof cod andherring, oil discharges etc. The state of the environment is shown in terms ofnitrogen, phosphorusand toxin levels. The consequences for biological diversity are for example thenumber of wildsalmon compared to farmed salmon. A relevant measure to ...

Salmon Syndrome M74: Cause Still A Mystery

...lso affected by M74.Reproductiveproblems in Baltic cod can, however, be explained by poor oxygen conditions initsfeeding grounds and heavy fishing pressure....

Alaska Sea Grant To Convene Ecosystem Considerations In Fisheries Management Conference

... dominated bycommercially valuable species such as cod and haddock, shifted to lower-valued species such as skatesand dogfish; and (2) Gulf of Alaska and Bering Sea, where declines of crabs and shrimps have givenrise to increasing pollock and flatfish. Severe economic hardships are associated with such d...

Scientists Trace Roots Of Protein That Keeps Antarctic Fish From Freezing

...le clearly shows thatthe antifreeze gene in Arctic cod is not related in gene structure nor incoding sequences to the Antarctic fish. "We found tremendous differences,"he said. In an accompanying journal commentary, John M. Logsdon Jr. and W. FordDoolittle of the Program in Evolutionary Biology at Dalho...

1 2

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition