The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "collaboration" at biology news

Scientists to prototype cyberinfrastructure for research and education access to ocean observatories

...sed a web services framework for LOOKING (in close collaboration with Bill St. Arnaud of the Canadian Network for the Advancement of Research, Industry and Education (CANARIE); WHOI will flesh this out with middleware and test the result using existing ocean observatories and terrestrial IT infrastructure. The oth...

Rare childhood genetic syndrome identified

...Research Division at Children's Hospital Boston in collaboration with the University of Utah and the Boston University School of Medicine. The researchers will continue to treat patients with Timothy syndrome and evaluate their response to calcium-blockers. They will also continue to look for arrhythmia genes an...

Chemical derived from vitamin-E shows early promise as cancer drug

...ment of Human Ecology who directed the research in collaboration with Bob G. Sanders, a professor in the School of Biological Sciences. The findings will be published in the October issue of Experimental Biology and Medicine. They result from studies involving treatment of genetically identical mice, which wer...

Schepens Eye Research Institute receives 'Roadmap' grant to develop center for curing eye diseases

...ploratory Centers, we hope to remove roadblocks to collaboration so that a true meeting of minds can take place that will broaden the scope of investigation, yield fresh and possibly unexpected insights, and create solutions to biomedical problems that have not been solved using traditional, disciplinary approache...

Study: Emission of smog ingredients from trees is increasing rapidly

...urves, a postdoctoral fellow, wrote the article in collaboration with Stephen Pacala, professor of ecology and evolutionary biology at Princeton, as well as John Casperson of the University of Toronto, Paul Moorcroft of Harvard University and George Hurtt of the University of New Hampshire. The article is schedule...

UCSF scientist Joe Derisi named MaCarthur Fellow

... in their debut, wreak havoc on people's lives. In collaboration with infectious disease specialist Don Ganem, MD, and pulmonologist Homer Boushey, MD, he is studying the viruses that may cause or exacerbate respiratory illnesses, including asthma. (Currently, scientists are only able to determine the specific vir...

USAID, Conservation International & Starbucks launch Conservation Coffee Alliance in Central America

...arbucks and CI began working together in 1998, the collaboration has produced significant benefits for habitat conservation and farmer livelihoods in Mexico, Colombia and Peru. Beginning with its flagship site along the buffer zone of the El Triunfo Biosphere Reserve in southern Mexico, CI has established several...

Indiana University, EPA to study airborne PCBs

...ounced today (Sept. 27) that it would continue its collaboration with Indiana University Bloomington environmental scientists Ronald Hites and Ilora Basu to study the toxin's circulation between the air and the Great Lakes. What the scientists learn will help the EPA determine whether new PCB clean-up policies are...

Tracing genes, biologists show lizard migration is traced to Florida

... a genetic database for Anolis sagrei developed in collaboration with fellow Washington University graduate student Richard Glor, he then analyzed the introduced samples in comparison to the Cuban ones, not only in Florida but also in Hawaii, Taiwan, Jamaica, Grenada and Grand Cayman. The researchers were...

UCI scientists successfully target key HIV protein; breakthrough may lead to new drug therapies

...olved a partnership among three laboratories and a collaboration of scientists in chemistry, molecular biology, biochemistry and pathology. Besides Weiss, co-authors of the study are Allison Olszewski, Ken Sato, Zachary D. Aron, Frederick Cohen, Aleishia Harris, Brenda R. McDougall, W. Edward Robinson Jr., and Lar...

Researchers create nanotubes that change colors, form 'nanocarpet' and kill bacteria

...nuing our investigations of this novel material in collaboration with our colleagues here at the University of Pittsburgh and the U.S. Army Research Office," added Dr. Russell....

Flexible pain relief with morphine-free poppy

...rom the Australian Government through HAL and is a collaboration between CSIRO Plant Industry, The Australian National University, Tasmanian Alkaloids, Institute for Plant Biochemistry (Germany) and the University Halle (Germany)....

Groundbreaking research could ignite new solutions to heat transfer in nano-devices

... about any molecule." Key to the discovery was the collaboration between the faculty members of both institutions of higher learning. A research concept developed at Scranton was put in practice using an advanced laser technology called IR Raman Spectroscopy at theUniversity of Illinois. The laser measures the beh...

$7.5 Million grant to Yale researchers for role of viruses in cancer

...RNAs that she studies were first identified in the collaboration with Miller supported by this grant. Joann Sweasy , associate professor of Therapeutic Radiology and Genetics , investigates the role of mutant DNA polymerases in inducing cancer. Collaborating with DiMaio, she has found that some cancers ...

The book opens on the first tree genome

...s Facility. "By helping to lead this international collaboration to sequence the first tree genome, DOE once again is pioneering discovery-class science that promises to yield important societal benefits," said Secretary of Energy Spencer Abraham. "The poplar genome sequence will provide researchers with a critic...

NSF awards 22 new projects for plant genome research

...on goal. One center, led by New York University in collaboration with the New York Botanical Garden, the American M...eeds. The second center, led by Yale University in collaboration with the University of California, Davis, will focus on using experimental approaches to define ever...

Northeastern University receives $12.4 million NSF grant for creation of nanomanufacturing institute

...ing and sensor technology, the NSF grant creates a collaboration between the mechanical and electrical engineering, physics, chemistry, philosophy and political science departments at the university, as well as industry and partner universities (UML, UNH and MSU). " Northeastern aims to be at the forefront of nan...

Study reveals why eyes in some paintings seem to follow viewers

...at the University of Utrecht in The Netherlands in collaboration with Jan Koenderink, Andrea van Doorn, and Astrid Kappers. Their results were published in a recent issue of the journal Perception . While scientists have considered the reasons behind this visual effect for more than a century, advances in the fie...

Students build submarine to track Octopuses

...adow its every move. UA engineering undergrads, in collaboration with students from two other universities, are building a mini-sub to answer this need. In July, they took a prototype to Alaska for testing. Appropriately named Shadow III -- and painted a bright yellow that belies its sleuthy assignment -- the mini...

Genetic modification of linseed produces healthier omega 3 and 6 fatty acids

...n seed. The work is the result of an international collaboration between scientists at several research institutions in Germany (University of Hamburg, BASF Plant Science GmbH and Forschungszentrum Borstel), Rothamsted Research Station in the U.K., and Kansas State University in the U.S. This research is an excell...

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)...IS, Dec. 2 While many Am...mic challenges including rising costs of,basic ne...ress Scripts,(Nasdaq: ESRX ) has expanded Rx Ou...rescription medicines. , (Logo: http://ww...LOGO ) , Lower-income consumers can now rec...
(Date:12/1/2008)...GO New research reveals that computed tomography ...py, has the potential to screen for two diseases a...which commonly affect adults over age 50. Results ... meeting of the Radiological Society of North Amer... to screening for colorectal cancer, we were able ...
(Date:12/1/2008)...k Warren Presents Award, Engages with President on...Home and Abroad During Saddleback Civil Forum on G...wire/ -- President George W. Bush was honored on t...the "International Medal of PEACE" given by Dr. Ri...during the Saddleback Civil Forum on Global Health...
(Date:12/1/2008)...lls shut down and stop dividing when their DNA is ..., so as to prevent damaged DNA from leading to unr...er, a new study, published in this week,s issue of...hut down they also spew proteins into their surrou...ts up conditions that support the development of a...
Breaking Medicine News(10 mins):Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 2Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 3Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 4Health News:CT colonography offers 1-stop screening for cancer and osteoporosis 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 3Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 4Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 5Health News:Escape cancer, but age sooner? The dark side of the tumor suppressing process 2
Other Tagsrejecting 2simulates 2meal 2meal 3meal 4winner 2winner 3pair 2pair 3pair 4cheaper 2cheaper 3continue 2continue 3continue 4continue 5continue 6continue 7continue 8continue 9continue 10
maxinerejectingsimulatessfusodroskijoemealdemystifiessilverwickednesswinnerpaircheapercontinuetestifiessolitary