The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "consensus" at biology news

Lunch workshop at the American Association for the Advancement of Science (AAAS) Annual Meeting

...nters (CMSC) in meeting these challenges Previous consensus conferences utilizing this model The issue of an...Abs in the treatment of multiple sclerosis: global consensus development WHY: The advent of biologics (protein-based medications) has benefited countless pati...

NAFTA arbitrators in environmental case agree to formal public input, a first for trade hearings

...to all Chapter 11 proceedings (Mexico blocked full consensus on this). For more information on this case and IISD's wider work on investment rules and sustainable development, please see http://www.iisd.org/investment ....

Bridging the gap between genetics and motivations to drink alcohol

... to have negative ones." "Although there is much consensus that alcohol abuse and dependence are caused, in part, by genetic factors, there is less certainty concerning what is inherited and how that genetic vulnerability is manifested," added Kenneth J. Sher, Curators' Professor of psychological sciences at...

American Society for Microbiology publication provides guidance for shipping biological agents

...iques and Procedures in Clinical Microbiology) are consensus reports in booklet form on topics of special interest to clinical microbiology laboratories. Experts cover the optimal procedures for a variety of clinical microbiology techniques. Each Cumitech focuses on a particular diagnostic concern, laborator...

NIH consensus panel confirms effectiveness of total knee replacement

...of the health care system may all have a role. The consensus panel is calling for more research to determine th... hospitals. These findings are part of the panel's consensus statement, presented at the close of this three-day consensus development conference. The NIH Office...

Fishing gear fallout

...system based management, this report offers them a consensus view on gear impacts and suggests that addressing these ecological impacts is one avenue towards achieving this goal," state the researchers....

Clock cells, tumor suicide, tailored therapies among subjects of AACR-NCI-EORTC Conference

...rials nor the way cancer is classified. We need a consensus of opinion to bridge the gap between the lab and the patient." Target selection and barriers to the clinical testing of targeted agents will be debated by academic and pharmaceutical company scientists and federal regulators at two forums during ...

Study reveals patterns of gene activity in the mouse nervous system

...dvisory committee means this research is done with consensus from many parts of the neuroscience community," says Dr. Heintz. The committee members also help to evaluate ideas about how to use this research to advance neuroscience, he adds. The data already generated by the project provide immediate opportuni...

Rating the performance of residential fuel cells

...ons, government and academic representatives. With consensus procedures in place, fuel cell manufacturers should be able to evaluate and improve the electrical and thermal energy efficiency and output of their products. Ultimately, consumers will be able to use NIST-developed performance ratings to understand ...

New chemical process can separate, manipulate carbon nanotubes

...tronic structure of the nanotubes. "Until now, the consensus has been that the chemistry of a nanotube is dependent only on its diameter, with smaller tubes being less stable and more reactive," Strano said. "But that's clearly not the case here. Our reaction pathways are based on the electronic properties o...

CNRS use F1000 Biology to evaluate researchers

... rapid service, run by scientists, that provides a consensus view of important papers and trends across biology. Users can customize the service to their interests and opt for regular updates by email. Dave Weedon, Managing Director of Biology Reports Ltd is delighted by the move: "We are delighted that the CN...

New research challenges advice that men should abstain from sex before fertility treatment

...than two days." Dr. Levitas said there was no real consensus among researchers as to why sperm gets damaged and becomes less viable. "It's possible that there is oxidative DNA damage by, for example, cigarette smoking or other damaging agents. Or perhaps the sperm from oligozoospermic men is more susceptible t...

Top 25 turtles on death row

...Red List of Threatened Species, as well as general consensus between TCF's three partner organizations--the Center For Applied Biodiversity Science at Conservation International (CABS), The World Conservation Union Species Survival Commission's (IUCN/SSC) Tortoise and Freshwater Turtle Specialist Group (TFTSG)...

GenoMyc binding

...s focused on those genes that bind Myc through the consensus "E-box" DNA sequence (CACGTG). Dr. Amati and colleagues used bioinformatics tools to scan the human genome and identify genes containing one or more E-boxes in the proximity of their promoter (the portion of the gene where transcription begins). Of t...

Tracking every egg? AAAS report lists practical options for regulating human cloning

...diverse views. It therefore steers clear of making consensus recommendations, and instead lists options. For example, to support responsible research cloning, one workshop group proposed that: Research cloning methods should be approved only following animal studies; All donors must provide informed consen...

New age for Mungo Man, new human history

...ngo Man, Australia's oldest human remains, and the consensus is he is 22,000 years younger. A University of Melbourne-led team say Mungo Man's new age is 40,000 years, reigniting the debate for the 'Out of Africa' theory. The research also boosted the age of Mungo Lady, the world's first recorded cremation, b...

Scientists urge managers to limit use of destructive fishing gears

...as linked to particular gears, there is surprising consensus across these different communities." The authors hope that this finding will stimulate local, regional, national, and international conversations about how to reduce the collateral impacts of fishing. "Too often this problem has been overlooked or i...

Scientists crack the black box of coastal ecosystems

...y were prime targets for fishing. "There is strong consensus that the 'target species' approach is insufficient and there is emerging recognition of the need to switch to ecosystem-based management, yet there is precious little understanding of what that actually means," says Lubchenco. Ecosystem-based managem...

European scholars support development of germ line modification

...rs categorically reject it. Among the religions, a consensus on the moral status of embryos does not exist.Many Christians, however, oppose any instrumental use of the human embryo, and some oppose any treatment of the embryo in vitro. This opposition results in a clear rejection of most experiments that are c...

Council for Responsible Nutrition questions WAVE study conclusions

... Dr. Hathcock noted that there is broad scientific consensus that dietary supplements of vitamins E and C are safe in the general population. "It is the cumulative knowledge, or the weight of the overall evidence, that provides health care professionals and consumers with the best scientific guidance. Over t...

1 2 3 4

(Date:12/1/2008)...IS, Dec. 2 While many Am...mic challenges including rising costs of,basic ne...ress Scripts,(Nasdaq: ESRX ) has expanded Rx Ou...rescription medicines. , (Logo: http://ww...LOGO ) , Lower-income consumers can now rec...
(Date:12/1/2008)...GO New research reveals that computed tomography ...py, has the potential to screen for two diseases a...which commonly affect adults over age 50. Results ... meeting of the Radiological Society of North Amer... to screening for colorectal cancer, we were able ...
(Date:12/1/2008)...k Warren Presents Award, Engages with President on...Home and Abroad During Saddleback Civil Forum on G...wire/ -- President George W. Bush was honored on t...the "International Medal of PEACE" given by Dr. Ri...during the Saddleback Civil Forum on Global Health...
(Date:12/1/2008)...lls shut down and stop dividing when their DNA is ..., so as to prevent damaged DNA from leading to unr...er, a new study, published in this week,s issue of...hut down they also spew proteins into their surrou...ts up conditions that support the development of a...
Breaking Medicine News(10 mins):Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 2Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 3Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 4Health News:CT colonography offers 1-stop screening for cancer and osteoporosis 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 3Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 4Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 5Health News:Escape cancer, but age sooner? The dark side of the tumor suppressing process 2
Other Tagsrejecting 2simulates 2meal 2meal 3meal 4winner 2winner 3pair 2pair 3pair 4cheaper 2cheaper 3continue 2continue 3continue 4continue 5continue 6continue 7continue 8continue 9continue 10
maxinerejectingsimulatessfusodroskijoemealdemystifiessilverwickednesswinnerpaircheapercontinuetestifiessolitary