Tag: "continue" at biology news

Persistent Organic Pollutants, The Danger Is Not Over

... pollutants. "There is every reason to continue keeping a vigilant eye on what these chemicals are doing to the environment and to ourselves. We know, for example, that they can disrupt hormonal systems and we suspect that they can contribute to birth defects and health damage in in...

Artificial Heart Chamber And Artificial Blood Vessels Aid Cardiovascular Surgeons

...ent the functions of total artificial hearts,which continue to be studied at research centers here and abroad, said Dr. Runt. His research team is presently evaluating blood sacs from total artificialhearts that had been implanted in cows for over four months. The ultimate goalis to produce blood sacs that ...

University Of Kentucky Professor Teaches First Reproductive Laboratory Science Class In The United States

...icipated to grow as regulations of ARTlaboratories continue to increase. Baker also developed a compact disk for ART technologists nationwide touse to train on semen analysis. Baker says many of the technologists working inlaboratories have been trained incorrectly to complete semen analysis,therefor...

Plant Doctors Find Genetic Solution For Papaya Growers

...ntheir mouths while feeding on infected plants and continue to feed on healthyplants, was first detected in Hawaii in the 1940's and virtually eliminatedlarge papaya production on Oahu in the 1950's. The papaya industry relocated tothe Puna district on Hawaii island in the early 1960's. Plant doctors realize...

Biotech Foods Ready For Primetime, Experts Say

...ys, and for that reason biotech-derived foods will continue to appear on the market. "Biological processes are so complex and diverse that somewhere there's an organism that is able to inhibit the growth of the soybean cyst nematode, the leading soybean pest," he says. "We will find that organism, identify th...

Science Article Criticizes Federal Policy Regarding Lead Exposure And Children's Health

...uly exposed," says Dr. Lanphear. "Yet, ourefforts continue to focus on secondary prevention -- screening children forelevated blood lead levels and controlling lead hazards after a child has beenunduly exposed. It's time to establish a scientifically based strategy toeliminate lead toxicity by controlling r...

Researchers Offer DOD New Hazardous Waste Clean-Up Methods

...ing recommended for use by theDOD, and others will continue to be tested. Some of the projects focused on contaminants that are difficult to cleanup, such as chemicals associated with the energy industry called heavyhydrocarbons, dense liquids called chlorinated solvents, and difficult soilconditions,...

University Of Kentucky Researcher Awarded MERIT Extension For Study Of Third World Killer

...iseases at the NIH has awarded Turco $1,583,700 to continue hisstudy, "Glycoconjugates of Leishmania." Leishmania donovani, a one-cell parasite, is one of the world's majorpathogens. It afflicts 10 to 20 million people in Mediterranean and Third World countries. Theparasite is transmitted by sand fl...

Phase III Results Suggest Potent Antiviral Activity For Vertex And Glaxo Wellcomes Second-Generation HIV Protease Inhibitor Agenerase TM

... Assessments of antiviral activity and safety will continue until thelast subject completes 48 weeks on study. "The considerable body of data now available suggests that Agenerase iswell-suited to the current standard of care and the need for simplerregimens," commented Dr. Vicki Sato, Senior Vice President ...

Researchers Grow Healthy Human Placental Cells For Drug Research

... they aren’t certain how long the cells will continue to grow if left alone. Not only did the trophoblast cells reproduce in the bioreactor, but they became fully functional. The cells sprouted villi, the tree-like projections with which they absorb materials from the placenta. Kni...

40 Percent Of Deaths Are Environmental

...efforts," they predicted, "disease prevalence will continue its rapid rise throughout the world and will diminish the quality of life for all humans."...

Major Plant Genome Research Project Grants Renewed

...two groupsof researchers through renewal grants to continue systematic large-scale genomesequencing of the plant named Arabidopsis thaliana. The ultimate goal is tosequence the entire Arabidopsis genome and to determine the structure andfunction of every gene in this model plant. The combined three-year awa...

Lake George Water Is Death On Zebra Mussel Larvae

...a mussels a foothold," she said. "But our findings continue to provide hope that Lake George will escape thedevastating impact that other lakes have experienced when these menacing musselstake up residency," Nierzwicki-Bauer said. A zebra mussel pair can produce and fertilize several million eggs a year."That...

Teaching Great White Sharks To Link People With Food Is A Recipe For Disaster

...ist boats have moved on to other sites, the sharks continue to react to boatengines-which can prevent other di...will curb theworst excesses. "The authorities will continue to put commercial venturesfirst," he says. Author:Andy York New Scientist magazine, issue 24th Octo...

Cold Virus With P53 Gene Tested To Combat Ovarian Cancer

...ithtwo-week intervals between them. Patients will continue treatments as long as apositive response occurs unless significant side effects develop. Fifteen to 18patients are expected to be treated in this study. Nancy Ruff, a 65-year-old wife, mother and grandmother, never intended to be apioneer. Butwhen s...

Cell Suicide Prevented By Survival Signals

...ution d efective), isalso expressed in cells that continue to live, indicating that the killingactivity of the Hid protein must be kept in check by other mechanisms. In the Cell article, Steller's team now reports that Hid is thetarget of survival signals, such as growth factors, received from theextrace...

New Hypothesis Proposed For Cause Of Chronic Fatigue Syndrome

...ms routinely linger for six months or more and may continue for years. The federal Centers for Disease Control and Prevention estimate that CFS may affect anywhere from four to 10 of every 100,000 people in the United States. Other researchers have reported higher-than-normal titers of ...

Virginia Tech Scientist Seek Genetic Solution To Malaria

... before she came to Virginia Tech inJuly. She will continue to collaborate with the Army, which has a variety ofresearch programs concerning mosquitoes because of the potential for soldiers tofind themselves in areas where malaria is prevalent. Her work is also supported by grants from the National I...

Aluminium Study Puts Drinking Water In The Clear

...ts indicate that water authorities can confidently continue to usealum to treat drinking water with minimal risk to human health," Dr. Staubersays. The study into drinking water was supported by a related report identifyingsources of aluminium in the Australian diet (see attachment for details). Thisstudy wa...

University Of Chicago Professor Wins $50,000 Bristol-Myers Squibb Award For Distinguished Achievement In Infectious Disease Research

...to ensure the survival of the host so that it will continue to replicate," Dr.Roizman says. The virus behaves differently, however, in differentenvironments. In some people, it exists only in latent form. In others, ittriggers mouth or genital sores. And in one in 250,000, for reasons as yetunknown, it pe...

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid