The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "control" at biology news

Cellular Engineers Design Custom Cell Surfaces Able To Adhere To Synthetic Materials

... these markers, cell surfaces can be engineered to control celladhesion to synthetic organic polymers, metals...g toxins. "Our primary goal is to take control of the cell surface," saysBertozzi, who is a member of Berkeley Lab's Biomolecular Materials Progra...

Similarities Found In Human, Chimp Brains; Columbia, Mount Sinai, NIH Scientists Find Region That Controls Language Identical In Both Species

...th have found that a region of the brain thoughtto control language is proportionately the same size in human...rtex, also known as Wernicke's area, wasthought to control language comprehension, but only in humans. "After 100 years of people doing comparative bra...

Study Reviews Medication Use In Elderly Cardiac Patients After Discharge

... of medication often needs to be modified and pain control is frequently anissue," says Cheryl Dellasega, Ph.D., associate professor of nursing andbiobehavioral health at Penn State's College of Health and Human Development."And, more than 50 percent of the patients in this survey went home with atleast 10 d...

National Laboratory Known For Environmental Technology Directing Attention On Solving Agriculture And Food Processing Problems

...microbial ecology,foodborne pathogen detection and control systems, pollution prevention,value-added processe...ped. The laboratory's extensive background in arms control nonproliferation detectionand monitoring will serve as a solid foundation for the remote sensing ele...

Tiger Beetles Go Blind At High Speeds

...been published in a peer-reviewed article, "Visual control of cursorial prey pursuit by tiger beetles ( Cicindelidae )," in the Journal of Comparative Physiology Fall 1997. But, just how fast is fast for a tiger beetle? Gilbert compared an ordinary tiger beetle to Olympic superstar Michael Johnson. Jo...

Genetic Risk Factors For Anorexia Nervosa Sought

Modern society puts powerful pressure on women to control body weight,penalizing obesity and rewarding thinness in myriad ways. For this reason, someobservers say, women suffer from anorexia nervosa -- a disorder in which victimsstarve themselves, sometimes to death -- at rates 10 times higher than men.Rece...

Careful Honeybee Breeding Combats Tracheal Mite Pests

...e to tracheal mites, pests thatbeekeepers normally control with insecticide. The research indicates tha...ee Journal , Cobey explained how beekeepers could control trachealmites effectively over the long term -- by breeding bees that carry thegenetic traits that h...

'Rolling Circles' Provide New Way to Amplify and Detect DNA

...s of DNA after clipping by enzymes. "Wecan easily control the length of the DNA strand created by arolling circle simply by varying the enzyme or the duration of the reaction," he notes. The technology relies on tricking the polymerases that copyDNA strands. These enzymes start at one end of a strand...

Scientists Work To Restore Native Fish And Habitat To Great Lakes

...ices, two fish health centers, and two sea lamprey control stations spread across the United States from Wyom...t of different pieces, including restored habitat, control of invading species like the sea lamprey, and healthy fish from our hatcheries, to come together at ...

Emory University Fragile X Group Receives NIH Program Grant

...ion of FMR1 knockout mice in whichthey can closely control FMRP expression, both pre- and postnatally, throughdrug exposure. The investigators also will address fundamental questionsrelating to possible future therapeutic strategies. Stephen T. Warren, Ph.D., is the only Howard Hughes Medical Insti...

IFT Report Describes Challenges Of Food Industry Stepping Up To The P(a)lates Of Consumers

...void introducing microbialhazards. Other control measures that may enhance food safety and are commerciallyapplied include irradiation (approved for meat and poultry, but not seafood),the bacteriocin nisin (an anti-microbial protein produced by certain bacteria),and high hydrostatic pressure. ...

Virginia Tech Engineers Help Mother Nature Clean Up

...anted poplar trees on top of aVirginia landfill to control the moisture on the surface of thesites. "Within three years, the deep root systems of thetrees were accomplishing a lot," says Novak. At the Oneida Tie Yard Site, Novak and Widdowsonhave also added a grass study. They are excavating the contamina...

Good Ergonomics Is Good Economics

...analysis, design, evaluation, standardization, and control of systems. It is this technology that clearly def...oped System Link, an ergonomically oriented remote control that can operate various types of products made by different manufacturers. The original Thomson rem...

Scientists Identify Protein Essential For Iron Absorption, Boost Understanding Of Iron-Deficiency Anemia

... in ironmetabolism. "The body has control mechanisms that maintain homeostasis in ironmetabolism,"Garrick explained. "So if you are iron-deficient, you're very efficient atabsorbing iron from food. If you are iron-replete, then you will be much lessefficient at iron uptake." ...

Low Cholesterol? Reduced Sodium? What Do These Terms Really Mean?

...onents(fat, sugar, sodium and cholesterol) and one control label with no added image.The images were placed i...er than the FDA limits. From the responses to the control labels, it is apparent that subjects haddifferent perceptions of the contents of the four different ...

Microsurgery Made More Accurate With Virtual Measuring Tool

... human operator employs a three degree-of- freedom control device to manipulate the 3D pointer. The pointer is first placed adjacent to an object feature of interest in the stereo-video image. When the pointer is placed adjacent to a second location of interest, the absolute distance between the two points i...

Corn Rootworm Changing Behavior, Posing New Threat To Crops

...ois, it would costfarmers $100 million per year to control rootworms chemically if the corn-soybeancrop rotation fails to control them. "For 1998, we have the makings of a big problem in the affectedarea," said Eli Levine, an ent...

TSRI Scientists Discover Naturally-Occurring Mechanism Involved In Regulation Of Angiogenesis; New Anti-Cancer Therapeutic Agents Are Suggested

...n on-off switch for blood vessel development, or a control mechanismthat establishes appropriate blood vessel... of PEXat sites of neovascularization may not only control normal angiogenesis, butwhen administered in sufficient quantities, may provide a naturally-occurrin...

Study Finds Gene Is Associated With Higher Risk Of One Kind of Stroke Among African-Americans

...percent were black. In comparison to a control group of 1,899 people, there was astatistically si...ble e4 frequenciesbetween the ICH patients and the control group, due largely to the increasedfrequency of e4 in the black patients. "In our study grou...

Research Finds Alligator Problems Also Evident In Less Polluted Lakes

...es" when measured against the alligators in their control lake, he said. Hormonal irregularities found in Lake Okeechobee alligators were not as severe across-the-board as the Lake Apopka alligators, but a number of measures were troublesome, he said. "The thing that now concerns us about Lake Okeechobee i...

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)...IS, Dec. 2 While many Am...mic challenges including rising costs of,basic ne...ress Scripts,(Nasdaq: ESRX ) has expanded Rx Ou...rescription medicines. , (Logo: http://ww...LOGO ) , Lower-income consumers can now rec...
(Date:12/1/2008)...GO New research reveals that computed tomography ...py, has the potential to screen for two diseases a...which commonly affect adults over age 50. Results ... meeting of the Radiological Society of North Amer... to screening for colorectal cancer, we were able ...
(Date:12/1/2008)...k Warren Presents Award, Engages with President on...Home and Abroad During Saddleback Civil Forum on G...wire/ -- President George W. Bush was honored on t...the "International Medal of PEACE" given by Dr. Ri...during the Saddleback Civil Forum on Global Health...
(Date:12/1/2008)...lls shut down and stop dividing when their DNA is ..., so as to prevent damaged DNA from leading to unr...er, a new study, published in this week,s issue of...hut down they also spew proteins into their surrou...ts up conditions that support the development of a...
Breaking Medicine News(10 mins):Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 2Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 3Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 4Health News:CT colonography offers 1-stop screening for cancer and osteoporosis 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 3Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 4Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 5Health News:Escape cancer, but age sooner? The dark side of the tumor suppressing process 2
Other Tagsrejecting 2simulates 2meal 2meal 3meal 4winner 2winner 3pair 2pair 3pair 4cheaper 2cheaper 3continue 2continue 3continue 4continue 5continue 6continue 7continue 8continue 9continue 10
maxinerejectingsimulatessfusodroskijoemealdemystifiessilverwickednesswinnerpaircheapercontinuetestifiessolitary