Tag: "could" at biology news

UT Southwestern biochemist honored with NIH Director's Pioneer Award

...by my peers as a pioneer is the highest accolade I could possibly imagine receiving. I'm on cloud nine to hear that I was selected to receive one of the inaugural Pioneer Awards from the National Institutes of Health." One of the most significant turns Dr. McKnight took in his career was to move from h...

Phase II trials of second-generation antisense cancer drug planned following successful early study

...e designed the Phase I trial in such a way that we could identify the biologically active dose in the tumour tissue. Being able to identify the active dose in this way gives us confidence that the Phase II dose of the drug that we have selected is the appropriate one. The Phase II studies are of a more con...

Cancer vaccine based on pathogenic listeria bacteria shows promise targeting metastases

...le of a tumor that has a high recurrence rate that could potentially be knocked back with a listeria-based ...ed more than once. A listeria-based cancer vaccine could thus be given periodically until a tumor has responded. Despite these attributes, the one problem wi...

Award winning researchers reveal potential new role for Glivec

...ar analysis to select more accurately patients who could benefit from targeted therapeutics. We are confident that this approach will first benefit patients by tailoring their treatments and avoiding unnecessary therapy and often toxic 'trial and error' probabilistic prescriptions. It will also aid regulat...

Trial shows which brain cancer patients benefit from temozolomide

...iopsies to identify who will benefit from the drug could be carried out fairly easily in any genetics labor...tients without methylation, future clinical trials could be designed evaluating new treatments rather than treatments with temozolomide. Temozolomide would n...

Genetic differences might help distinguish thyroid cancers

...C cells. They further found that five genes could distinguish the two tumor types. The researchers used microarray analysis, which reveals the activity levels of tens of thousands of genes at one time, to compare gene activity in cells from six PTC tumors, nine FTC tumors and 13 samples of no...

New Arizona State center brings science to policy on issues of water resources and urban growth

...ter, called the Decision Center for a Desert City, could have a profound effect on the future directions of...limatic uncertainty. The impact of the NSF centers could be felt for years to come as populations move to areas that struggle to achieve sustainability. "...

Cardiac arrest may hinder ability to learn certain tasks

...al, healthy neurons," DeVries said. "These changes could be part of the physiological basis for memory defi... each mouse had learned where the platform was and could swim to it directly regardless of where the mouse was placed in the tank. All of the mice were...

Researchers identify protein promoting vascular tumor growth

...eans that therapies to eliminate the MCP-1 protein could be a key to healing or preventing the tumors and ...ther tumors, as well," Gordillo said. "The concept could be applicable to a broad variety of tumors in which we know MCP-1 is expressed." ...

Winning combination to build bone density in children

...calcium per day. For this study, vigorous activity could include actions like running, playing tag, jumping rope, etc. "You don't have to jump rope for half an hour. That would be considered very hard. In reality we are talking about the sort of energy you would expect kids to expend when playing around...

Study: Emission of smog ingredients from trees is increasing rapidly

...but that doesn't seem to exist." The findings also could raise questions about potential strategies for dev...may have more of one species than another, and you could call that natural change. But here in New Jersey, the mix of trees is affected by the population of ...

Gene clusters predict atherosclerosis severity, susceptibility

...ically, the researchers found that their new model could predict with 93.5 percent accuracy the extent of atherosclerosis. It could also predict with 93.6 percent accuracy the location of atherosclerotic lesions. "This study is ...

UCSF scientist Joe Derisi named MaCarthur Fellow

...xpectation. Among the many lucrative projects that could be tackled with microarray technology, Joe has focused a significant fraction of his research on malaria, a disease primarily afflicting the Third World. This focus is motivated by his genuine desire to have a positive impact on the human condition."...

Newly identified master gene key in baby's first breath

... first breath a newborn infant takes. The findings could have implications for treating premature babies an...ery of this gene and understanding of how it works could lead to new treatments for premature infants and for children and adults who suffer from lung diseas...

A test case for DNA barcodes to identify species

...call species." As their technology matures, it could radically advance biologists' attempts to achieve the long-standing goal of cataloging life on earth, but the approach is very controversial, with critics questioning both the method and its applications. As Craig Moritz and Carla Cicero from the Uni...

Atacama rover helps NASA learn to search for life on Mars

...ing NASA learn more about how primitive life forms could exist on Mars. The NASA-funded researchers are studying the Atacama Desert, described as the most arid region on Earth, to understand the desert as a habitat that represents one of the limits of life on Earth. The project, part of NASA's Astrobiolog...

Hidden diversity: DNA 'barcoding' reveals a common butterfly is actually 10 different species

...00 wild-caught caterpillars of A. fulgerator, many could be separated by slight variations in color, which then could be linked to the particular plants the caterpillars ate. It soon became obvious that A. fulgerator...

Wisconsin scientists develop quick botox test

... rapid-fire tests for botulinum toxin, a feat that could underpin new technologies to thwart bioterrorism a...me assay," says Chapman, suggesting the technology could potentially be deployed to protect the food supply, soldiers on the battlefield, or used by emergenc...

DNA barcode finds four new bird species

...nd-held device that amateur naturalists and others could take outdoors for species identification. "Ne...d species by Hebert, Stoeckle and their colleagues could allow non-specialists to make these same species identifications using a relatively simple and inexp...

Researchers devise potent new tools to curb ivory poaching

...of determining the geographic origin of ivory that could prove a potent tool in slowing elephant poaching a...e received, an exemption from the ban so that they could conduct one-time ivory sales. Now numerous other countries are considering seeking exemptions, and s...

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid