The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "could" at biology news

Tracing genes, biologists show lizard migration is traced to Florida

...but the genes being mixed in Florida and elsewhere could potentially speed up evolution. What took millions of years before is happening in dozens of years, maybe even faster than that."...

Knock knock knocking on rhythm's neural doors

...the case: the authors find that "discrete movement could indeed be generated with the help of the rhythmic movement system." "What our results indicate is that we really deal with two very separate systems in movement," says Schaal. "There is an automatic system that, literally, functions without any thoug...

Fortifying food with folic acid benefits babies

...te about whether an increased intake of folic acid could mask the symptoms of vitamin B12 deficiency, a disorder that affects 10-15% of the population over 60. Yet this study provided no evidence for a deterioration in vitamin B12 status in seniors, and no evidence that improved levels of blood folate mask...

UCI scientists successfully target key HIV protein; breakthrough may lead to new drug therapies

...mless virus, then created synthetic molecules that could target and dislodge the protein. This is the firs...st is a bacterium), which provided a 'handle' that could be tracked by the researchers to determine whether Nef was binding to three cellular proteins, as is...

Researchers create nanotubes that change colors, form 'nanocarpet' and kill bacteria

... more firm structure. Polymerized, these nanotubes could change from blue to other colors, depending on its exposure to different materials. For instance, in tests with acids and detergents, they turned red or yellow. The most critical tests, say the researchers, were those involving E. coli, which were c...

Alaska scientists find Arctic tundra yields surprising carbon loss

...plication of this research is that climate warming could lead to a much greater release of carbon dioxide t...interrupted research in a pristine environment. We could never have gotten the results we did without such a long-term experiment," said Bret-Harte. "The con...

Master of antimalarial resistance

...pfcrt's "central role" in malarial drug resistance could "help in the development of new therapeutic strategies that are effective against chloroquine-resistant parasites," said David Fidock of Albert Einstein College of Medicine, one of the lead authors of the paper. Nearly three million people, mostly ch...

Pollutant causes delayed flowering in plants

...mitted as air pollutants from burning fossil fuels could affect the critical process of plant flowering. Si... so critical to reproduction, a delay in flowering could have important impacts on ecosystems, both plant and animal, they said. The researchers, led by Duke...

Keep genome data freely accessible

...t, a terrorist organisation, or even an individual could use data from these repositories to create novel pathogens that could be used as weapons.' 'The current system also offers tremendous benefits. The panel, which was commi...

Flexible pain relief with morphine-free poppy

A handful of genes in a morphine free poppy could hold the key to producing improved pain management pharmaceuticals. Norman, the 'no-morphine' poppy, is superior to morphine producing poppies as it produces thebaine and oripavine compounds preferred by industry in the manufacture of alternative hi...

'Gene chips' research in cotton could lead to superior variety

...sands of different DNA elements in a cotton plant, could lead to cotton varieties with superior traits and improved fiber quality. Dr. Jeff Chen, a Texas Agricultural Experiment Station scientist, is working on a $5.7 million National Science Foundation project led by Thomas Osborn at the University of W...

Females may be more susceptible to overindulge 'sweet tooth' cravings than males

...e rate of obesity is greater in women than in men, could it be that women are at a disadvantage when it com...osed to succumb to the temptation to overeat? And could exercise be a less effective method of appetite suppression in women than in men? Researchers at T...

Enzyme maintaining chromosome ends is linked to bone cancer recurrence, decreased survival

...lts are preliminary, they might lead to tests that could identify children at high risk for treatment failure or death. That could help physicians determine how to modify therapies to improve chances of success in the future. The f...

Anthrax enzyme images reveal secrets of antibiotic resistance, suggest new drug design

...ed as a potential bioterrorism weapon. The finding could also be the basis for a broad-spectrum antibiotic ...anyway. Either way, our new molecule looks like it could be the basis of a very effective new antibiotic against anthrax bacteria." In addition, because man...

New fossil sheds light on old mystery

...of an attack but also creates a pressure wave that could push the prey away. Fish and some turtles combat these factors with suction feeding, i.e., pulling the prey into their months by rapidly expanding the mouth cavity. Crocodiles and alligators use a different approach. They catch prey with their flat h...

Groundbreaking research could ignite new solutions to heat transfer in nano-devices

...s created at the molecular level, an approach that could have far reaching implications for developing nano-devices. Research results to be published in the upcoming issue of Science, detail a collaborative effort involving The University of Scranton, a Jesuit university in Pennsylvania, and the University...

Florida Tech earns $50,000 grant to create coral database

...ng of the distribution and abundance of corals and could eventually provide information required to detect shifting patterns of degradation and recovery at both the local and regional levels. The ability to forecast the response of reef corals to environmental conditions, as a function of natural variabil...

New hydrothermal vents discovered as 'South Pacific Odyssey' research begins

...seafloor. About a mile and a half down, the basin could hold answers to questions about the origin of life on Earth, say the scientists, whose plans for their "South Pacific Odyssey" include an unprecedented number of research expeditions to this geologically unique "back-arc basin" during the next two ye...

A long-necked sea predator from China described in Science

...t which is unlike other protorosaurs, the creature could have attacked with jaws opening sideways like a cr...action of Dinocephalosaurus' proposed neck muscles could have rapidly straightened the neck and splayed the neck ribs outward. This could have increased thro...

New signs of life found at the Poles

...f as extreme for example other planets like Mars could nurture surprising habitats for life. The Poles are not the barren wilderness, devoid of life as we previously thought"....

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)...IS, Dec. 2 While many Am...mic challenges including rising costs of,basic ne...ress Scripts,(Nasdaq: ESRX ) has expanded Rx Ou...rescription medicines. , (Logo: http://ww...LOGO ) , Lower-income consumers can now rec...
(Date:12/1/2008)...GO New research reveals that computed tomography ...py, has the potential to screen for two diseases a...which commonly affect adults over age 50. Results ... meeting of the Radiological Society of North Amer... to screening for colorectal cancer, we were able ...
(Date:12/1/2008)...k Warren Presents Award, Engages with President on...Home and Abroad During Saddleback Civil Forum on G...wire/ -- President George W. Bush was honored on t...the "International Medal of PEACE" given by Dr. Ri...during the Saddleback Civil Forum on Global Health...
(Date:12/1/2008)...lls shut down and stop dividing when their DNA is ..., so as to prevent damaged DNA from leading to unr...er, a new study, published in this week,s issue of...hut down they also spew proteins into their surrou...ts up conditions that support the development of a...
Breaking Medicine News(10 mins):Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 2Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 3Health News:Amid Economic Crisis, Express Scripts Offers Easy and Affordable Way for Lower-Income Consumers to Get Six-Month Supply of Prescription Medicines 4Health News:CT colonography offers 1-stop screening for cancer and osteoporosis 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 2Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 3Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 4Health News:President George W. Bush Receives 'International Medal of PEACE' That Coincides With PEPFAR Milestone on World Aids Day: 5Health News:Escape cancer, but age sooner? The dark side of the tumor suppressing process 2
Other Tagsrejecting 2simulates 2meal 2meal 3meal 4winner 2winner 3pair 2pair 3pair 4cheaper 2cheaper 3continue 2continue 3continue 4continue 5continue 6continue 7continue 8continue 9continue 10
maxinerejectingsimulatessfusodroskijoemealdemystifiessilverwickednesswinnerpaircheapercontinuetestifiessolitary