Tag: "crustacean" at biology news

ConocoPhillips & Conservation International launch 'Biodiversity Action Plan' in Venezuela

...The AquaRAP team discovered 41 fish species, eight crustacean species and 15 benthic invertebrates (microcrustac...lly, the team discovered two fish species and five crustacean species not previously known to science. In total, 96 species of invertebrates and 106 species of ...

Two-month study of life in mid-Atlantic yields trove of species, new insights & questions

...earchers. While the suspected burrower is a large crustacean or deep-sea blind lobster, several questions linger. "Perhaps each line is a burrow with multiple entries, or is it a succession of burrows with just a single opening, but then how and why can these lines be that straight?" ("Fig. 16." Photo credit...

Secret behind hard exoskeletons, spreading wings revealed

... that the very same cells produce another protein, crustacean cardioactive peptide (CCAP)," Honegger said. "We used a molecular probe that would attach to bursicon messenger RNA and an antibody that would work against CCAP. From the reaction, we saw that the same cell was producing both. The molecular probe sho...

Mantis shrimp may have swiftest kick in the animal kingdom

...sley. The fastest punches are delivered by a lowly crustacean - the stomatopod, or mantis shrimp. With the help of a BBC camera crew and the loan of a high-speed video camera, University of California, Berkeley, scientists have recorded the swiftest kick, and perhaps most brutal attack, of any predator. The shr...

Genetic master switch sends bacteria toward 'seafood dinner'

...n the flurry of skeletal debris discarded daily by crustacean creatures in the world's oceans. If left undisturbed, this tough insoluble material, a cousin to cellulose, would pile up on the ocean's floor and wreak havoc with marine ecosystems. Fortunately, armies of bacteria act as chitin's cleanup crew, and t...

Mantis shrimp fluoresce to enhance signaling in the dim ocean depths

...topod, L. glabriuscula, a 22-centimeter (8.5-inch) crustacean that occurs throughout the western Atlantic, from the Carolinas to Brazil, the fluorescence is apparently a common characteristic of many other species of these crustaceans. "It turns out that that Lysiosquillina glabriuscula was just the tip of the ...

Midwest wetlands almost gone but may still have most species

...ngs to extrapolate backwards and estimate how many crustacean species were there originally and how many have go...buted they are.Jenkins and his colleagues found 33 crustacean species in the ponds they studied. These included fairy shrimp, which are large (up to 1.5 inches),...

Grant from Vetlesen Foundation supports URI Graduate School of Oceanography Climate Research

...eorges Bank. Calanus finmarchicus is a microscopic crustacean that feeds off phytoplankton and is a favorite food of cod and haddock. Durbin and Luo will use the Princeton Ocean Model with a high resolution grid to determine if seasonal variations in Calanus transport can be linked to climatic variations such a...

Japanese shore crabs invade Penobscot Bay, Maine

...hey're here. Japanese shore crabs, a square-shaped crustacean that poses a direct threat to soft-shell (steamer) clams, mussels and lobsters, were discovered July 13 by Cornell University marine biologists in Owl's Head, Maine, on the shores of Penobscot Bay. The detection of this crab, which has the potential...

Scripps scientists find ignored species play key role in ecosystem interactions

...t the UC Davis Center for Population Biology. "One crustacean might not seem important, but en masse they can have a long-term ecological effect. So studying diversity is very important, especially in figuring out who is doing what within the community."...

First genetic evidence uncovered of how major changes in body shapes occurred during early animal evolution

...ic development. Using laboratory fruit flies and a crustacean known as Artemia, or brine shrimp, the scientists showed how modifications in the Hox gene Ubx-which suppresses 100 percent of the limb development in the thoracic region of fruit flies, but only 15 percent in Artemia-would have allowed the crustacea...

Integrative approach to studying penguins, cockroaches and little hairy noses makes comparative biomechanics group at UC Berkeley the nation's best

...ng models of lobster antennules to learn how these crustacean noses pluck odor molecules from the water swirling around them. These half-dozen UC Berkeley professors in the Department of Integrative Biology comprise the largest and most diverse group in the country studying how animals -- including humans -- mo...

Pollution makes crustaceans adapt rapidly

...hers already had learned how to awaken300-year-old crustacean eggs. Working at Lake Constance, the biologists neededto go back only 37 years, beginning with Daphnia eggs that were depositedon the lake bottom in 1962, to trace the clever crustaceans' evolution. Theyhatched Daphnia eggs that piled up year a...

Mapping The Way To A Bigger Prawn

...percent. The map, which is a world-first for any crustacean species, will also be used to help identify genes for other important traits such as those which influence flesh quality and disease resistance. This early success has resulted in a growing international interest in CSIROs activities in the area ...

1

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning