Tag: "cultures" at biology news

Grant advances biochemical engineering laboratory

...taminant environment for the transfer of microbial cultures in student fermentation experiments. The grant also will be used to acquire a new pilot-scale fermentation vessel that will demonstrate problems with mixing, aeration, cooling and sterilization associated with the scale-up of microbial fermentations....

Scientists explore genome of methane-breathing microbe

...live inside of animals and cannot be grown in pure cultures on their own,"says Eisen. "Since the symbionts are closely related evolutionarily and biologically to Methylococcus capsulatus, we can now use the information gleaned from this genome sequence to make predictions about the symbionts."...

Genes expose secrets of sex on the side

... of patrilocality. About 70 percent of the world's cultures practice patrilocality. When populations are compared, patrilocality would predict greater differences between populations in Y-chromosome DNA than in mitochondrial DNA, which is just what earlier population genetic research found. ...

Researchers identify distinctive signature for metastatic prostate cancer

...d that the Hedgehog pathway was, indeed, active in cultures of human metastatic prostate cancer cell lines. Bl...g-neutralizing antibody. In additional studies of cultures of cells that closely resemble these prostate progenitor cells, the researchers found that switching...

Smac-ing back at cancer cells

...aled itself when the scientists introduced it into cultures of human glioblastoma cells. "We picked human glio...e researchers added the Smac mimic to glioblastoma cultures -- along with a protein called TRAIL that also helps activate the apoptosis machinery -- it easily k...

Single isolated mouse skin cell can generate into variety of epidermal tissues

... and skin stem cells derived from mice, laboratory cultures of human adult skin stem cells and human embryonic stem cells, from both National Institutes of Health Registry and non-Registry cell lines. For more information, visit: http://www.rockefeller.edu/pubinfo/080304.php...

Anti-cancer compound in vegetables found to block late-stage breast-cancer cell growth

...ls and cancer chemoprevention, and Jackson exposed cultures of malignant human breast cancer cells to SUL. Within hours, SUL blocked cell division and disrupted microtubules, which are long, slender cylinders made up of tubulin (protein), that are essential for the separation of duplicated chromosomes during...

Light turns on anticancer agents

...wer's chemistry-biology group is working with cell cultures to compare the effectiveness of the agents in the dark and in visible light. "Another improvement for our systems is that the agents are activated by visible light, as opposed to UV light," said Brewer, associate professor of chemistry. "Using only v...

Testing the fitness of biological clocks

...ur; 22 hour and 30 hour. Then they put these mixed cultures into incubators with three different light-dark cy...tored them for about a month. When they pulled the cultures out, the researchers found that the strain whose internal clock most closely matched the light-dark ...

8 environmental stewards win $900,000 in biodiversity awards

... Those uncertainties are partly based on the dual cultures of New Caledonia--native Melanesians and Europeans. Geraux has begun to forge relationships between the communities involved. He has written: "I am personally convinced that the future success of conservation initiatives must be built on supporting t...

New UCF researchers, college will help fight Alzheimer's disease, cancer

...ts they've noticed working with cells grown in lab cultures also show up in actual tumor cells. He also is beginning to study whether regulating levels of a protein called KIP through drugs could be an effective way to fight cancer. Muller has founded several companies, including TopoGEN Inc., which is develo...

Firefly compound lights up 'protein dance' in living animals

...have studied these interactions previously in cell cultures and in solutions obtained by carefully opening up cells. Luciferase has been used previously to identify the presence of molecules in the cell and in live animals, but this is the first time scientists have used it in the test tube or in live animals...

Brookhaven lab biophysicist F. William Studier wins R&D 100 award

...of the day monitoring the growth of many different cultures to get optimum conditions for producing proteins, we simply inoculate cultures late in the day, let autoinduction do the work for us, and collect our proteins the next morning. A...

Gene defects found in age-related macular degeneration

...esearchers' next steps will include producing cell cultures and animal models that harbor the mutations identified in the NEJM study. These steps will help researchers determine whether the fibulin proteins do have an altered function that would produce AMD. The discovery of the AMD-related mutations in th...

Chemical Society announces EPA awards for environmentally friendly technology

...PCF) technology. This new process using plant cell cultures saves energy, improves worker safety and eliminates tons of waste. Buckman Laboratories International, Inc. (Memphis, Tenn.) Recycling can be a sticky business when lingering adhesives on envelopes, magazine binding and other materials gum up the ...

Strengthening independent junior research groups in collaborative research centres

..., since it does not do justice to all disciplinary cultures and routes of qualification. Instead, researchers ...of social orders in transition: comparisons across cultures and times" examines the development of images, symbols and behaviour as signs of social reality. Res...

After natural disasters, the risk of infection, epidemics from dead bodies is negligible

...ct for the dead is a value deeply ingrained in all cultures and religions, it can be difficult to separate respect for the deceased from the deep fear of death itself that is common to all human beings, the editorial notes. Sometimes feeling pressured by misleading media reports on the supposed dangers from c...

International research conferences at the Villa Vigoni

...humanities from different countries and linguistic cultures constitute the background for this initiative. The lingua franca of international scientific cooperation is English. For researchers in the engineering and natural sciences, this is a matter of course and poses no problems, since their research is ge...

Indoor mold, building dampness linked to respiratory problems and require better prevention

... out the possibility. Studies on animals and cell cultures in labs have found toxic effects from various microbial agents, raising concerns about whether these same agents growing in buildings can cause illness in people. Molds that are capable of producing toxins do grow indoors, and toxic and inflammatory...

Promising research: From employment issues to virology

... onwards cover such topics as the use of concrete, cultures in the Middle Ages, astrophysics and the kinships of animals. The Senate of the DFG selected them from among 80 applications and will provide a total of 32.6 million to support them during the first two years. This raises the number of Priority Prog...

1 2 3 4 5 6 7 8 9 10

(Date:6/18/2013)... "What if adding one simple act ... your health and well-being? Well, there is something easy ... "It is called Skin Brushing ." , Skin ... lost art. Now, people are rediscovering this great health ... so do certain health conscious people. Sublime Beauty® wants ...
(Date:6/18/2013)... New York, New York (PRWEB) June 19, 2013 ... dedicated to protecting the rights of victims injured by ... on behalf of an Arizona woman who alleges that ... The suit was filed on May 30th in the ... Virginia (Civil Action No. 2:13-cv-12677) in the multidistrict litigation ...
(Date:6/18/2013)... Looking for a way to break out of the ... IWALKAWAKE is a guide to unlocking one’s true potential through ... on harnessing the powerful and abundant spiritual presence that is ... guide to finding one’s true purpose and potential. These nine ... to reach their true potential. The awakenings deal with subjects ...
(Date:6/18/2013)... Daily Gossip Magazine has always kept its readers entertained by ... The magazine has decided to prepare readers for the summer ... every week . , According to Daily Gossip ... who are looking to get insights into this type of ... food is almost entirely based on healthy, yet tasteful products. ...
(Date:6/18/2013)... 18, 2013 SEATTLE, WA—A Washington state ... Fairview, Oregon, claiming he fell ill with a hepatitis ... pomegranate seed blend. The complaint was filed in ... Clark, the Seattle-based law firm that has filed ... to the complaint, Brian Brothers consumed “Townsend Farms Organic ...
Breaking Medicine News(10 mins):Health News:The Easiest Way to Contribute to Better Health and Well-Being Starting Today and for Under $20, Says Sublime Beauty® 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 3Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 4Health News:Anabolic Cooking Book Review Exposes Dave Ruel’s Top 10 ‘Anabolicious’ Recipes for BodyBuilders 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 3
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma