Tag: "cure" at biology news

International Research Team Clones New Skin Cancer Gene

...ournal Cell, could lead to a skin cream that would cure the disease, and to genetic testing for susceptibility to skin cancer. Approximately one million cases of basal cell carcinoma occur each year, and its incidence is on the rise. The new gene, called PTC, is essential for keeping skin cells under con...

Low-Protein Diet May Reverse Kidney Disease

...y low protein diet with amino acid supplements may cure a severe kidney disease in some people, a Johns Hopkins study shows. The results suggest the dietary therapy should be tried before drug treatment for nephrotic syndrome, a chronic kidney disorder that often leads to kidney failure. Scientists have n...

NIH Team Discovers Endocrine Tumor Gene

...hen associated with MEN1, HPT is more difficult to cure because all the parathyroid glands are affected by multiple tumors. Another consequence of MEN1 may be too much gastrin in blood, which causes severe stomach ulcers that are sometimes fatal. Some islet cell tumors may become malignant and result in...

Researchers Find Production Point Of Key Protein In Fragile X Syndrome

...e for AdvancedScience and Technology. There is no cure for fragile X syndrome, which is caused by the geneticinability to normally produce the fragile X protein. "Fragile X"refers to the broken appearance of the X chromosome -- half the chromosomepair that determines sex -- when cells are cultured under ...

Huntington's Disease Findings Pave Way For Potential Cure

...ed--and the newfindings may lead to a treatment or cure for the progressive, degenerative braindisease. ...lood test can detect the HD gene, but there is no cure and no effectivetreatment. In a second study in the current issue of Cell, an internationalgroup led...

Scientists Unlock Mystery Behind Proteins That Keep Tuberculosis Bacteria Alive; Finding Leads To Research Into New Drug Treatments

...cteria, but thelong-term drug treatments needed to cure the disease give the organism time tomutate into new, resistant forms. Making treatment even more difficult is thefact that many TB sufferers stop taking antibiotics before the bacteria iseliminated. "This is a breakthrough because it offers ...

Study: Device Prevents Epileptic Seizures, Doesn't Damage Hearts

...lepsy. "This device is neither a cure for epilepsy nor a substitute formedication or epilepsy surgery, but it is useful for otherwise healthy peoplewith no heart or lung problems who have not responded to medication and havefrequent seizures," Vaughn said. "It may be applicable to thousa...

$3 Million From Defense Department Will Fund Next Phase Of UT Southwestern's Gulf War Syndrome Research

...e to combinations of toxic chemicals. "There is no cure for nerve damage," Haley said. "But just as we treat but cannot cure diabetes, we believe we can find treatments to allow these Gulf War veterans to live more comfortabl...

Popular 'Cure-All' Tea Can Cause Toxic Reactions

...ternative health beverage that has been toutedas a cure for everything from wrinkles to cancer, has landed at least fourpeople in the hospital with dangerous side effects. Radhika Srinivasan, MD, of Texas Tech Health Sciences Center and herco-authors have documented four patients who developed sym...

Gene Locus Found For Essential Tremor Disorder

...than Parkinson's. At thepresent time, there is no cure for ET and the only available treatments aremedications such as the anti-seizure medication primidone and thebeta-adrenergic blocking agent propranolol. Extreme cases of ET sometimesrequire surgery. These therapies offer only partial relief from th...

Gene Therapy Trial Takes Aim At Deadly Brain Cancer

...ts are designed to reduce symptoms, rather than cure the disease. In the laboratory, mouse cells are transfected with a genetically engineered mouse leukemia virus that includes the herpes simplex gene for thymidine kinase. This genetically engineered “composite” virus will infe...

Discovery Channel Returns From Underwater Scientific Expedition Off The Coast Of Cuba

...at may have significance in providing drugsfor the cure of human disease. On Friday, January 2, the crew of the SEWARD JOHNSON received a surprise visit from Cuban President Fidel Castro. Castro has longbeen interested in underwater expedition and he spent two hours on the boat talking with the scient...

Hurdle In Ulcer Vaccine Development Cleared

..."So there's a real need for new ways to prevent or cure H. pyloriinfection," says Douglas E. Berg, Ph.D., the American member of the researchteam. "In places where people are at high risk for infection, such as shantytowns in developing countries, reinfection after curing with antibiotics iscommonplace. S...

Experimental Trial Combines DNA Vaccine With Triple-Drug Therapy To Stop HIV

...in patientswith triple-drug therapy, which doesn't cure them but dramatically lowers theirviral load, allowing them perhaps to mount a more robust immune response. Thenwe're giving them the improved vaccine." Immunologically, the concept of a therapeutic DNA vaccine for a viralinfection poses som...

Curing Malaria, Controlling Mosquitoes Symposium Set For AAAS Meeting

...n last fall among experts who are trying to find a cure fordrug-resistant forms of malaria, investigating ways to control the breeding ofmosquitoes, and developing transmission-blocking vaccines for malaria. The AAAS annual meeting will take place from February 12-17 at thePennsylvania Convention ...

Leftover Fetal Cells May Affect Development Of Scleroderma

...nd joints. Currently there is no way to prevent or cure scleroderma, buttreatment can relieve some symptoms. ***Study Details*** The study was conducted in two parts. Part one enrolled 40 women, average agemid-40s, who had previously given birth to at least one son. This groupincluded 17 scleroderma p...

Carbon In Boreal Forests: Temporary Or Permanent?

...turned toward Canadianboreal forests as a possible cure for the excessive carbon dioxide in theatmosphere. Satellite data and field experiments have indicated that globalwarming could stimulate the growth of boreal forests, thereby removing some ofour carbon from the air. Can boreal forests be a sink of c...

Cystic Fibrosis Foundation Launches Innovative Therapeutics Development Centers

...on is to assure the development of the means to cure and control cystic fibrosis and to improve the quality of life for those with the disease....

Late Blight Battle Goes Online, Marking 150 Year Struggle Since Irish Potato Famine

...the potato for their food. The struggle to find a cure for this disasteractually led to the birth of plant pathology as a science." Plant pathologists have made significant headway in the past 150 years, but thedisease in its varied strains still persists. "The impact of these new strainshas a devast...

UNC-CH Researchers Discover Key Cancer Control Mechanism

...ect it earlier. "While this work is not a cure for cancer, it is very important forseveral reasons," said Dr. Yue Xiong, assistant professor of biochemistry at theUNC Lineberger Comprehensive Cancer Center. "First, it provides a mechanism bywhich ARF suppresses tumor growth. It also may explain w...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... MinuteHound, a leading time and attendance technology ... up to 8% on payroll costs. MinuteHound’s system eliminates ... systems. Their biometric system is simple: Employees place their ... in and out automatically. Employee time clocks ... punching. , Because the fingerprint data is encrypted ...
(Date:6/19/2013)... Faith4Kidz is starting a new fundraising effrt to support ... help showing support for kids to learn how to independently ... out the website, http://www.gracenfaith.com to see Faith4Kidz logo ... and blue stars as a symbol of our country and ... as the stars we should encourage our children to reach ...
(Date:6/18/2013)... 2013 As a sponsor of the 2013 Fourth of ... at Lake Meridian Chiropractic want you to get out and celebrate! ... the event and are excited to be involved. “My husband and ... always loved going to the Kent Splash event. It's a tradition ... sense to financially support this fun day.” , The ...
(Date:6/18/2013)... York (PRWEB) June 19, 2013 Parker ... the rights of victims injured by dangerous drugs and ... an Arizona woman who alleges that she was ... filed on May 30th in the U.S. District Court ... No. 2:13-cv-12677) in the multidistrict litigation entitled In Re: ...
(Date:6/18/2013)... Daily Gossip Magazine has always kept its readers entertained ... , The magazine has decided to prepare readers for the ... recipe every week . , According to Daily Gossip ... readers who are looking to get insights into this type ... anabolic food is almost entirely based on healthy, yet tasteful ...
Breaking Medicine News(10 mins):Health News:MinuteHound Announces How Cloud Computing Technology Boosts Savings 2Health News:MinuteHound Announces How Cloud Computing Technology Boosts Savings 3Health News:Faith4Kidz Introduces Patriotic Hats to Benefit the "Grace in Faith Equals Peace" Mission 2Health News:Lake Meridian Chiropractic of Kent, WA to Sponsor the Fireworks Finale at 15th Annual Fourth of July Splash 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 3Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 4Health News:Anabolic Cooking Book Review Exposes Dave Ruel’s Top 10 ‘Anabolicious’ Recipes for BodyBuilders 2
Other Tags
primitivespecificdamagehavewilsonlocalizedantibacterialgalliumstandlegalflawedfatallysimilarpeersattractattitudes