Tag: "decreases" at biology news

CU studies suggest exercise protects body against negative effects of stress from brain to cell

...tress, including the suppression of cell division, decreases in cytokines and increases in the production of stress proteins. In fact, the physically active stressed rats had elevated levels of interleukin-2 and interferon-g, proteins essential for fighting disease. "Our goal is to understand how regular...

How alcohol use during pregnancy can lead to attention-deficit/hyperactivity disorder

... the brain focus attention. Fetal alcohol exposure decreases the activity of dopamine neurons in the midbrain area, decreasing attention. Stimulants like Ritalin can increase focus by restoring dopamine deficits. The relationship between fetal alcohol exposure and brain function is as complex as the brain it...

Feeding the world by cleaning the air: study ties heavy regional haze to reductions in China's crop production

...eaching key rice and winter wheat crops. That decreases plant growth and food production. "For crops that are irrigated and fertilized, there is often a direct correlation between how much is grown and how much sunlight reaches those crops," said Dr. William L. Chameides, professor in the Sc...

Multiple studies show that psyllium lowers cholesterol

...ebo group. Over 8 weeks of treatment, overall decreases in cholesterol levels were encouraging: LDL choles...red to focus on the reduction of LDL. In general, decreases in ratios of LDL to HDL cholesterol were greater in the older age group, with very little differenc...

ASM statements on FY 2001 federal budget proposal: NIH, CDC, NSF

...t funding for bioterrorism preparedness activities decreases by $6.5 million to a level of $148.5 million. An effective national program for bioterrorism preparedness and response is needed to stop bioterrorism incidents and save lives. The Administration deserves credit for initiating funding for bioterrorism...

Gene therapy halts HIV replication in cells from infected patients

...al therapy (HAART). HAART, a combination of drugs, decreases HIV replication to undetectable levels in many patients, confining the virus in a latent state. However, recent studies have suggested that HAART alone will not lead to eradication of the virus in the infected cells. In addition, the treatment is ver...

Athletes take note: Not all energy bars built the same

...ce more moderate increases and decreases in blood sugar levels than a typical candy bar," said Steve Hertzler, an associate professor of medical dietetics at Ohio State. "But these claims aren't necessarily valid." His study appear...

New science resources available from the ESA

...conclude that ecosystem productivity and stability decreases with a reduced number and variety of species in a community (biodiversity), a point long debated by ecologists. They specifically found that reducing biodiversity reduces plant productivity, ecosystem resistance to environmental events such as droug...

Upper Columbia River: Some fish contaminants decreasing, USGS study shows

... fish--including Lake Roosevelt--have found either decreases or no change in levels of mercury, dioxins and furans, and PCBs, according to a report released today by the U.S. Department of the Interior, U.S. Geological Survey.The report was prepared in cooperation with the Lake Roosevelt Water Quality Council....

Microbes on Earth may be key to identifying life on other planets

...ses such as carbon dioxide de-gassing, temperature decreases and possibly evaporation are the primary environmental controls on travertine mineralogy, Fouke said. "So the environmental context could be the key to determining whether or not a particular feature is an entombed microbe." On Earth, microbes also ...

Acid rain revisited: ESA releases report on the ecological response to acid deposition

...mission reductions of sulfur dioxide correspond to decreases in the fluxes of sulfate in both precipitation and surface waters. But in some regions and ecosystems, these reductions may not have resulted in ecosystem recovery. Several factors may be limiting this recovery. First, acid deposition can deplete ba...

Mice unable to synthesize vitamin C should become valuable research tool, scientists say

...their total cholesterol can be measured along with decreases inhigh-density lipoproteins, the so-called "good cholesterol," she said. But themost striking effects of insufficient vitamin C in the mice are abnormal changesin the wall of the aorta, the main artery channeling blood from the heart to thebody. ...

By all measurements -- Indiana's forests are growing

...ion of cropland and pasture to forestland. Slight decreases have occurred in the south central and southwestern parts of Indiana. Eighty-five percent (85%) of these timberlands are in private ownership. Not only have the number of forested acres increased, but also the total number of trees increased to 2 bi...

Folic acid supplements and fortified breakfast cereals can reduce homocysteine levels and ischemic heart disease risk

... and the supplement group experienced significant decreases in tHcy, 24% and 21% respectively, potentially translating into 30-40% decreases in ischemic heart disease risk. In accounting for the lesser effectiveness of adding folate-rich foo...

The glycemic index: Rethinking diet and cardiovascular risk

A diet which decreases fat and increases carbohydrate is frequently prescribed for preventing cardiovascular disease (CVD). According to a new study in The American Journal of Clinical Nutrition, the decision to substitute carbohydrates for fats should take into considerat...

Rickets making comeback among breastfed infants, especially blacks, N.C. doctors find

...n protects people from excessive sunlight, it also decreases natural production of vitamin D. Although almost perfect otherwise, breast milk is not a good source of vitamin D. Also, on average, people of all races in the United States are outdoors far less than their ancestors. "For the past million years, pe...

Parkinsons disease is more than just a brain disorder

...ch patients blow into a tube, producing temporary decreases in the amount of blood pumped by the heart. Peopl...his tightening does not occur, and blood pressure decreases progressively, causing orthostatic hypotension. Dr. Goldstein and his colleagues are now carrying ...

Scientists pinpoint mechanism for UV damage to rice plants

...the deficiency were: 1) a regulatory mutation that decreases production of the repair enzyme, or 2) a structural mutation that leads to a functionally defective enzyme, but in normal amounts. In the current research, the two used a "photoflash" technique to sort it out. Sutherland explains: The normal repair ...

Weight training may improve strength, health of older men

..., includingincreases in HDL cholesterol levels and decreases in LDL cholesterol levels. Losing muscle tone and strength is not uncommon for many senior citizens,Staron said, but this research suggests that a lack of physical exercisecan contribute to the problem. "Certainly, inactivity does play a role in co...

Estrogen therapy may help prevent memory decline in elderly women

...information, to consolidate and retrieve it - that decreases with aging. Our studies have found that estrogen replacement therapy prevents some of the decline in the ability to learn and to remember new material in postmenopausal women. " Mens and womens bodies make both estrogen and androgen, albeit in diffe...

1 2 3 4 5 6 7 8 9 10

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded