Tag: "degeneration" at biology news

New clues to hereditary blinding disease found

...ill misfold and break down, triggering cell death, degeneration of the retina and eventually blindness," said John Hwa, MD, PhD, assistant professor of pharmacology and toxicology at Dartmouth Medical School. "What is especially exciting about this new direction in our research is that this characteristic of rho...

Newly discovered protein may be key to muscular dystrophy

...uscular dystrophy, a disease of progressive muscle degeneration with no known cure. Scientists at UCSF's Erne...choline away from the nerve-muscle synapse. Muscle degeneration is the hallmark of muscular dystrophy, one of the most common genetic diseases. The study was ...

Disruption of protein-folding causes neurodegeneration, mental retardation

...roteins into their proper shapes, triggering nerve degeneration and mental retardation in children. This finding,...ses are responsible for most severe cases of nerve degeneration and mental retardation among children. The discovery identifies for the first time the endoplasmic ...

Protein is key to fatal disorder and normal cell function

...ontrolled apoptosis, or cell death, and the neural degeneration that is a hallmark of Batten disease. "Genetic diseases such as Batten disease provide a unique opportunity to understand the role of proteins, like cln3, that are vital for normal cell function," said Rose-Mary Boustany, M.D., a professor of pediatr...

JCI table of contents September 15, 2004

...Veins of Thought for Retinal Degeneration Retinal degeneration is inherited by as many as 1 in 3,500 individuals....er, if the vasculature atrophy is secondary to the degeneration of the retina. To investigate the importance of vascular atrophy in retinal degeneration, Martin Fri...

Study explores gene transfer to modify underlying course of Alzheimer's disease

...kin cells. Alzheimer's disease is caused by brain degeneration and is marked by the death of cells, particularly ...f cells (cholinergic neurons) which undergo severe degeneration and death in Alzheimer's disease patients. NGF restored atrophied (shrunken) brain cells to near-nor...

Schepens Eye Research Institute receives 'Roadmap' grant to develop center for curing eye diseases

...diseases is becoming critical. Age-related macular degeneration affects more than 1.75 million individuals in the United States. This number is expected to increase to almost 3 million by 2020.Each year 1.3 million Americans over age 20 are diagnosed with diabetic retinopathy. The financial impact and effect on q...

1 2 3 4 5 6 7 8 9

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument