Tag: "designer" at biology news

Scientists using gene chips identify a unique form of leukemia

...e of leukemia that might someday be treatable with designer drugs specifically targeted to it. The discovery will help researchers single out the abnormal genes that make the leukemia so difficult to treat, as well as identifying new targets within the cancer cells for drugs that would be more selective than...

Study reveals new information on how viruses enter cells

...This information could eventually help in creating designer viruses that could be the next class of antibiotics." Analysis of the cell-puncturing device also reveals a structure that may hold potential for applications in nanotechnology, such as microscopic probes, Rossmann says. "This a very stable s...

Insulin in heart development

...ell types, and the more subtle phenotypes in these designer mice offer deeper insights into the effects of insulin resistance in specific energy-storing or -consuming organs in the adult animal. Thus, skeletal muscle-specific IR knockout (MIRKO) mice have been available for several years, and animals lacking ...

14th EORTC NCI AACR Symposium

...cuss the latest research on new molecular targets, designer diagnostics and prognostics, smart drugs and other novel approaches to tackling cancer. NB: the official language of the symposium is English. All press materials will be in English. If you haven't yet registered please return the attached form, with...

From designer milk to 'green' cows: predictions for milk and dairy products in the next 50 years

...lly bred cows that naturally produce low-fat milk, designer milk that boosts the immune system, and "green" co...eady available at supermarkets, but a new breed of designer milks are on the drawing board that will boost immunity, improve lactose utilization and relieve dia...

Designer molecules correct RNA splicing defects: New strategy for treating many diseases

...of the BRCA1 gene implicated in breast cancer. The designer molecules successfully caused the splicing machine...e of BRCA1 mRNA that is usually skipped. Thus, the designer molecules corrected the splicing error, making a normal messenger RNA from a defective pre-messenger...

MIT sugars research affecting bypass patients, drug industry

...ofessor, Ram Sasisekharan, reports the creation of designer drugs for preventing the blood clots that can caus...Brigham and Women's Hospital. "The benefits of new designer heparin fragments now need testing in clinical trials." Authors of the paper are from MIT's Biologic...

Research shows cocaine 'reward' picture more complicated than scientists thought

...or dopamine and the other for norepinephrine. Such designer animals, dubbed "knock-out mice," have proven invaluable for studying the activity of many genes both in health and sickness. It was possible, the scientists thought, that without those two mediators of cocaine's effects, the brain could not to proce...

Gene helps regulate longevity in flies, and perhaps humans

... and other complex traits in animals. "We can make designer genotypes in fruit flies and test the effects of mutations," said Mackay. The three variants interacted in a complex way to affect variation in longevity. Some variants in the DDC gene increased life span of the fruit flies and others decreased it. ...

Designer proteins

... A new computational method makes the search for designer matches much easier. The scientists take the molecule they know they want the protein to bind to, such as TNT, and try trillions upon trillions of combinations of the different amino acids (building blocks of the protein) to see which would best bin...

Targeting hard-to-kill fungal infections

...cell types while sparing surrounding tissue. These designer antibodies, armed with radioactive isotopes, have been found to be highly effective against some types of cancer, but the combination may also be useful in other types of serious disease. This technique is known as radioimmunotherapy (RIT). A study a...

Athletics, genetic enhancement and ethics

...s, that recently identified the previously unknown designer steroid, THG, will outline current pharmacological doping methods and banned substances. Catlin will describe how steroids get on the banned list, how THG is unique, and what the lab went through to identify the new steroid. Finally, Richard Pound fr...

Scientists calculate how high heels can go

...rs experience) wears her latest drop-dead gorgeous designer originals when sober, she can cope with a heel height of a staggering 12.5 centimetres (just over 5 inches) [See footnote 2]. However, if she over-indulges in cocktails, the 'safe' heel height (and perhaps also Carrie) plummets. Using the same examp...

Study suggests insect-derived antimicrobial peptides could be used as drug-delivery vehicles

...ls, an important type of immune cell, and that the designer pyrrhocoricin analog can penetrate both dendritic ...early-stage, and it remains to be seen whether his designer antimicrobial peptide analogs will be useful in activating dendritic cells as part of an immune ther...

Biocompatibility to widen scope of biomaterial applications

...ompatibility. One such development is tailor-made, designer polymers from a beaker by programming the modular ...aker' process aims at simplifying the synthesis of designer polymers through self-assembly using combinatorial chemistry. Researchers have used the same 'one-be...

'Smart gene therapy' protects against damage from heart attack

...d to rat hearts several weeks before ischemia, the designer gene combination protected the heart from much of the damage that may weaken the organ and lead to failure, according to the researchers. Their report will appear in a forthcoming issue of Proceedings of the National Academy of Sciences and in the jo...

Final Alert: 16th EORTC NCI AACR Symposium

...s on the latest research on new molecular targets, designer diagnostics and prognostics, smart drugs and other novel approaches to treatment....

Green, leafy spinach may soon power cellphones and laptops

...aterials that perform useful functions. One of his designer nanomaterials, which acts like the main ingredient in soaps and detergents, turns out to be ideal for keeping protein complexes functional on a cold, hard surface. The spinach-sandwich device has no water, and proteins usually need water to...

1 2

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills