Tag: "destroy" at biology news

Study Shows: Just Say NO To Bone Loss

...produce it because NO canact as a free radical and destroy cells. Philip Osdoby, Ph.D., professor of biolog... cells. "Nitric oxide, as a free radical, tends to destroy proteins and DNA and RNA, butit also acts as a signal molecule," Osdoby says. "We hope the informat...

Pitt Researchers Develop Strategy To Use Dendritic Cells To Treat And Prevent Tumors

...trategy torally the immune system to recognize and destroy established tumors and preventfuture tumors from developing. In a study published as a "Cutting Edge" article in the April 1 Journalof Immunology, Pitt researchers exposed dendritic cells (DC's) to melanoma orlung carcinoma cells for a short...

Purdue Herbarium -- A Noah's Ark For Egyptian Plants

...r, recognize that irrigation and agriculture could destroy some native plants and animals. Swinehart is one of several Purdue researchers who will visit the New Valley in May to count and identify the desert plants before irrigation begins. The group is working with Sayed Khalifa, professor of plant taxonomy...

Wistar Research Yields Information About Colorectal Cancer Cell Invasion

...specificlymphocytes or antibodies that may in turn destroy the cells bearing theantigens. In patients with colorectal cancer (CRC), however, the antigensexpressed by their growing tumors do not generally cause sufficient immunesystem responses to prevent the growth and spread of the tumor cells. Studies of...

Fetal Lead Exposure May Reduce Immunity

...t these levels is not the kind of assault that can destroy the kidneys in 24 hours," Dietert says. "These exposures take time to play out, but ultimately they can be just as problematic relative to quality of life." Writing in the toxicology journal, the Cornell researchers concluded: "Based on these resul...

Protein Implicated In Multiple Sclerosis

...ferate, generating more T cells that recognize and destroy virus-infectedcells. But in multiple sclerosis and...ells that attack PLP might be unable to bindto and destroy myelin. Patients therefore might remain in remission. "We wouldlike to perform a pilot study in five...

New Retinal Surgery May Reverse Legal Blindness

...he wet formof AMD with the laser is that you also destroy the functioning macula. That'slike cutting off a leg to save your life. You end up alive but disabled." In the new procedure, de Juan pinches the sclera, the white, outer partof the eye, as if it were a hollow rubber ball. Then he puts...

Toxic Protein That Interferes With Brain Signals May Trigger Onset Of Alzheimer's Disease

... P. Lambert, developed tests todetermine how ADDLs destroy nerve cells. These included use of a geneticallymodified animal which showed that ADDLs act through their receptors to activatea protein known as Fyn, a reaction that ultimately results in cell death.Neurons in the brains of people with Alzheimer's d...

Scientists Discover Proteins Which Help Set The Body's Clock

...There are retinal diseases inhumans and mice which destroy the image-forming layers of the retina but leavethe rest unharmed. Even though victims of these diseases are blind and cannotsee daylight, they still wake up in the morning and go to sleep at night thesame as the sighted. Dr. Sancar believes this hap...

University Of Pittsburgh Scientist Discovers How A Novel Vitamin K Stops Cancer Cell Growth

...unds not only can kill liver cancers, but also can destroy other types ofcancer in tissue cultures, including breast cancer and melanoma. They do so bya quite novel growth-regulating mechanism." "One of the attractive features of this unique compound is that itappears to stop cancer cell growth with...

HIV Infected Adults In UCSF Study Show Evidence Of Thymus Activity

...ymus. "Given the evidence that HIV can infect and destroy the thymus, this is anoutcome that is not predicted by textbooks or clinical experience," said JosephM. McCune, MD, PhD, associate professor of medicine at UC San Francisco, and anassociate investigator at the UCSF-affiliated Gladstone Institute of V...

Molecular "Fossils" Of Early Life

...fproteins" to get the amino acid "scissors," which destroy messenger ribonucleicacid (RNA) in humans and many other organisms. The feat was accomplished usinga technique known as test-tube evolution. Breaker's tailor-made enzyme is the first known nucleic acid enzyme thatuses an amino acid to trigge...

Boosting Immune Response Against HIV-1 Key To Controlling Infection, Say University Of Pittsburgh Researchers

...ls that can train killer T cells and other cellsto destroy foreign substances while at the same time signaling them to attack. DCs were taken from three HIV-infected study participants, stimulatedwith IL-12 and exposed to HIV-1 proteins encapsulated in a liposome, a tiny,fatty structure often used to...

Reengineered Poliovirus Proves Effective As Vector For Prompting Key Immune Response In A Study With Mice

...ing aresponse from CD8 T-cells, which seek out and destroy pathogen-infested cells. Previously, recombinant poliovirus vectors had only been demonstrated to inciteantibodies. When the mice, genetically altered to express the poliovirus receptor, wereinoculated, they developed a CD8 T-cell response. When the...

Dismantling Dangerous Genetic Codes With A Faster, More Flexible RNA Mimic

...cific regions of an HIV gene and cleave the RNA to destroy theharmful genetic message. He reported a higher ...sibility of damaging normal RNA. Speed is vital to destroy the harmful target right away. The method iscompatible with living cells and shows great promise fo...

University of Kentucky Neuroscientist Develops Unique Device For Treatment Of Brain Tumors

...remain active for a few hours -- not enoughtime to destroy the tumor. By running the tube directly into patients' tumors, Patchell has beenable to eliminate side effects normally associated with chemotherapy, such asnausea, hair loss and fatigue. The survival rates of patients who have triedSerodur ...

In New Alzheimer's Studies, Lab Tests Show Vitamin E And Other Antioxidants Preventing Brain Cell Death

...tely kill them; antioxidants aremolecules that can destroy these damaging free radicals. "I think it verylikely that as young people we have a tremendous amount of antioxidant strengthin our systems-but as we get older, the ability to reproduce these chemicalsweakens and free radicals more easily subvert th...

Cattle Diets Could Control E. Coli Danger

...nd fruit juices or thecooking of solid foods, will destroy "E. coli" bacteria. "E. coli" on theouter surfaces of a steak or chop are easily destroyed by heat of cooking. But "E. coli" in ground meat may be concealed deep within the hamburger. Hamburgershaving any "pink meat" can still have live "E. coli ...

Gene Therapy Animal Study Offers Hope For Some Neurodegenerative Diseases

...mes to developing genetherapy techniques that will destroy faulty gene products to a clinicallyrelevant degree. Scientists have thought that ribozymes would prove to be aneffective approach, and our study establishes that they are." In the study, conducted in rats, the DNA containing the code for specifical...

Could A 'Vaccine' Made From Our Own Cells Work Against HIV?

...ing B cells, they arepoor at triggering T cells to destroy infected cells. T cells are vital in thefight against Chlamydia and HIV. So Harlan Caldwell and his colleagues at the Rocky Mountain Laboratoryof the National Institute of Allergy and Infectious Diseases (NIAID) in Montanatried a different ap...

1 2 3 4 5 6 7 8 9 10

(Date:5/19/2013)... York, New York (PRWEB) May 19, 2013 ... that a Case Management Conference was recently convened for ... a federal multidistrict litigation now underway in U.S. District ... posted on the Court’s website on May 14th, the ... It was also reported during the Conference that ...
(Date:5/19/2013)... 2013 The Fat Loss Code program developed ... that help people get in shape, and gain a ... The program also is a natural fat loss system that ... author of this fat loss diet program claimed that The ... help people keep body fat off long-term. After Shawn Stevenson ...
(Date:5/19/2013)... Exciting new Skin Brushes are available ... great practice known through the ages but is a ... body brushing, has so many benefits for our health ... "We love that circulation and lymphatic systems get a ... skin, is supported through Skin Brushing." , Why is ...
(Date:5/19/2013)... 2013 The AMTC team will be screening ... Georgia Convention & Trade Center on June 1st. Professionals and ... auditions are free of charge. , Actors, Models and Talent ... of successful artists and grads like Caitlin Kinney - SYTYCD, ... , Chris Young - on his Liquid Neon 2013 Tour, ...
(Date:5/19/2013)... OH (PRWEB) May 19, 2013 The ... continue to follow developments in the nation’s first trial ... case, underway in Washington State Superior Court, was filed ... years after he suffered complications in a robot-assisted prostate ... The Da Vinci robotic surgery lawsuit alleges ...
Breaking Medicine News(10 mins):Health News:Pradaxa Lawyers at Bernstein Liebhard LLP Report on Recent Status Conference in Federal Pradaxa Litigation 2Health News:Pradaxa Lawyers at Bernstein Liebhard LLP Report on Recent Status Conference in Federal Pradaxa Litigation 3Health News:Weight Loss Secrets | How “The Fat Loss Code” Helps People Gain A Healthy Life And Get In Shape - Health Review 2Health News:Exciting New Skin Brushes at Sublime Beauty® Bring Health and Beauty Benefits; Celebrities and Models Know the Secret 2Health News:Actors, Models and Talent for Christ Hosting Auditions in Columbus, GA June 1st in Search of Local Talent 2Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 2Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 3Health News:Da Vinci Surgical Robot Lawyers at Wright & Schulte LLC Note Recent Developments in Da Vinci Robot Lawsuit Trial 4
Other Tags
manageradoptionhysteriagrapplingbrewsphysicistsmillipedescavemassesremovingcompletelyappropriatewiperelativelycursorsmalarial