Tag: "diets" at biology news

Molecule helps prevent inflammation and heart disease in fat-fed mice

...to Semenkovich, in the current climate of high-fat diets and rising rates of obesity. To test the role of b...t a complex interaction between beta3 and high-fat diets may contribute to heart disease and other inflammatory diseases," Semenkovich says. Puzzled by this ...

Researchers get to the root of cassava's cyanide-producing abilities

...little or no protein in their diets are particularly susceptible to cyanide poisoning, as they lack the proper amino acids necessary to help detoxify the poison. Sayre and Siritung...

Barrel structure in globular proteins may transport small molecules

...easons nutritionists advise people to eat balanced diets is because the nine essential amino acids must be ingested and are found in different foods. Histidine is one of the nine essential amino acids. Because histidine is a critical component of nearly all living systems, understanding how it is made is ...

Changing global nitrogen cycle impacting human health, says Colorado University-led study

... distribution and a growing tendency for unhealthy diets even in wealthy nations, the researchers concluded. In the United States, more than half of the grain produced is fed to animals, and corn is used much more widely as a sweetener than for human consumption. Meat consumption by humans has doubled wor...

Inflammation blocks impact of heart healthy diets for some

...in the failure of low-fat, so-called heart healthy diets to actually reduce cholesterol and heart disease r...research in this area could help physicians tailor diets for specific patients." While causes of inflammation vary, the condition itself has already been l...

Diet researcher asks how now lemur chow?

...s as cows are from dogs. Various lemur species eat diets as diverse as leaves, fruits, insects, seeds and nuts, she said. One lemur even eats bamboo containing enough natural cyanide to kill a full-grown human. After a trip to Madagascar in 1993, in which she helped care for newly captured sifakas, Campb...

Amphibians' life stages influence contaminant transfer from aquatic to terrestrial environments

...strial systems and are important prey items in the diets of birds and reptiles, according to Hopkins. He said body burdens of some contaminants, such as selenium and strontium, are retained through metamorphosis and they may be transferred into terrestrial food webs from wetland systems where they are tho...

Hypothesis linking flying foxes to high incidence of ALS/PDC gets boost from new study

...oxicity because they were an important part of the diets of both the flying foxes and the Chamorro. Although cycad seeds contain BMAA, the concentrations of the neurotoxin in processed cycad flour is believed to be too low to be toxic, and therefore their consumption was not associated with immediate ill e...

Worm farmers wriggle into US market

...id increase in demand for marine worms as hatchery diets in South America has increased the pressure on native USA stocks, traditionally supplied from the coast of Maine, and this has led to a decline in availability of wild collected worms. 'Seabait Ltd, through its American subsidiary, will make good t...

Couch potatoes may be created in the womb, not at the dinner table

...oping countries such as India and China as Western diets and lifestyle are adopted. Although the causes of ...ic diet The mineral and vitamin content in the two diets was identical and in accordance with the requirements for standard rat diets. Two separate studies w...

Study seeks genetic keys to exercise success

...ight is some form of diet, but research shows that diets fail to keep weight off," Jackson said. "The TIGER study uses a well-established exercise program that has been shown to educate students about how to exercise for fitness and control. A web-based computer program that computes energy expenditure l...

Few Filipino farmers know of the benefits of golden rice

...ly modified organisms) like golden rice as well as diets rich in vitamin A can help change these sobering statistics, but few science issues in recent years have elicited such polarized public reaction as biotechnology and its applications, says Chong. Indeed, even the Rockefeller Foundation, which funded ...

Lifestyle changes clinically effective

...ups of genetically compromised TRAMP mice were fed diets containing the same amount of calories, with eithe... author of the study. "Women need to modify their diets to include more fruits and vegetables to help prevent the disease," she said....

Ethical guidelines needed before 'nutrigenomic' groceries come to market

...earch designed to help consumers create customized diets based on their genetic make up will create ethical...ill not be long before the arrival of personalized diets tailored to genetic make up. A major target will be the baby boomers, reaching their 50s and 60s an...

Activity detailed for sirtuins, involved in metabolism, aging, gene expression

...pression. Some studies have shown that low-calorie diets that extend life also boost sirtuin activity drama...ime that there is a connection between low-calorie diets and longevity," says Ronen Marmorstein, Ph.D., a professor in the Gene Expression and Regulation Pro...

Lycopene's anti-cancer effect linked to other tomato components

...ted with a carcinogen to induce prostate cancer to diets containing whole tomato powder, pure lycopene or a control. Four weeks later, the rats were divided into two groups, with one having unlimited access to food and the second consuming 80 percent of the first's average daily intake. At the conclusion o...

Highlights of the November 2003 Journal of the American Dietetic Association

... that 26 percent of the respondents violated their diets when dining at restaurants and 21 percent didn't f...ocial functions. According to the respondents, the diets are too hard to maintain away from home. Celiac disease is an autoimmune disease that damages the vi...

Diet may improve cognition, slow aging, and help protect against cosmic radiation

..., and Francis Lau. "The findings also suggest that diets rich in natural antioxidants have the potential to...he control rats and those fed the antioxidant-rich diets responded similarly. When tested again at 12 months, however, the radiated rats that had been fed ei...

Age-related decrease in physical ability may be in the genes

... currently looking at the effects that low-calorie diets have on gene expression in the mouse cerebellum. Research in worms, yeast, mice and even monkeys has suggested that caloric restriction may lead to a longer life. "We want to see if caloric restriction prevents a drop-off in prolactin and growth horm...

Link between alcohol consumption and muscle damage in females

...laced by isocaloric glucose. Mean daily intakes of diets were 49 and 52 ml/day for female and male rats, respectively. Rats were killed, representative skeletal muscle (hindlimb musculature) was dissected into various regions and frozen immediately and stored until analysis. Study 2: Effects of acute etha...

1 2 3 4 5 6 7 8 9 10

(Date:8/29/2014)... Pursuing its deepest desires to help build ... stunning new design that promises to redefine the global ... surrogacy platform has witnessed a 42 percent increase in ... month, the FindSurrogateMother.com community is formed by hopeful parents ... — the precious gift of life. , Whether intended ...
(Date:8/29/2014)... News) -- If you have bunions, taking care of them ... expert says. A bunion is a bump that forms ... tissue moves out of place and extends beyond the normal ... pain and may require surgery to correct, said Brent Rosenthal, ... Freehold, N.J. To prevent bunions, avoid wearing shoes with ...
(Date:8/29/2014)... NEW YORK August 29, 2014 - Despite US ... obesity, there are many barriers, several of which may ... study by researchers at NYU Langone Medical Center published ... General Internal Medicine ( JGIM ). , David ... Department of Internal Medicine at NYU Langone, and colleagues ...
(Date:8/29/2014)... AURORA, Colo. (Sept. 2, 2014) A team of ... has reported the breakthrough discovery of a process to ... patients. These findings could have implications that extend beyond ... and autoimmune diseases., In an article published ... the Charles C. Gates Center for Regenerative Medicine and ...
(Date:8/29/2014)... 29, 2014 Today, NBC’s “The ... who profiled a handful of safe, back to ... Research. This year, many schools will include earphones ... innovator of hearing wellness solutions, offers the best ... Earphones, offered in yellow, pink and black, sound ...
Breaking Medicine News(10 mins):Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 2Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 3Health News:Take Steps to Control Bunions 2Health News:Options for weight loss your primary care doctor might not know about 2Health News:CU scientists' discovery could lead to new cancer treatment 2Health News:The Today Show Features ETY•Kids® Safe-Listening Earphones by Etymotic 2
Other Tags
hayfevershotantelopesaigakineticsilymarinplasticityinvasionsendocrineaaccmightdiscovereddefectataxiafriedreichreverses